Advanced Search (OLGA)

Gene: Vps33a (VPS33A core subunit of CORVET and HOPS complexes) Rattus norvegicus

Analyze

Symbol:

Vps33a

Name:

VPS33A core subunit of CORVET and HOPS complexes

RGD ID:

620643

Description:

Predicted to be involved in several processes, including autophagosome maturation; melanosome localization; and regulation of lysosomal lumen pH. Predicted to act upstream of or within pigmentation; platelet formation; and regulation of developmental pigmentation. Predicted to be located in autophagosome; endosome; and perinuclear region of cytoplasm. Predicted to be part of several cellular components, including AP-3 adaptor complex; CORVET complex; and clathrin complex. Predicted to be active in lysosome. Orthologous to human VPS33A (VPS33A core subunit of CORVET and HOPS complexes); INTERACTS WITH 2,6-dinitrotoluene; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

r-Vps33a; vacuolar protein sorting 33 homolog A; vacuolar protein sorting 33 homolog A (S. cerevisiae); vacuolar protein sorting 33A; vacuolar protein sorting 33A (yeast); vacuolar protein sorting protein 33a; vacuolar protein sorting-associated protein 33A; VPS33A CORVET/HOPS core subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VPS33A (VPS33A core subunit of CORVET and HOPS complexes)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Vps33a (VPS33A CORVET/HOPS core subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vps33a (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VPS33A (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VPS33A (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vps33a (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VPS33A (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VPS33A (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vps33a (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Vps33a (VPS33A core subunit of CORVET and HOPS complexes)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	VPS33A (VPS33A core subunit of CORVET and HOPS complexes)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vps33a (VPS33A CORVET/HOPS core subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vps33a (VPS33A core subunit of CORVET and HOPS complexes)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VPS33	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VPS33	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	car	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vps-33.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vps-33.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vps33a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vps33a	Alliance	DIOPT (OMA\|OrthoFinder)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,685,484 - 38,710,668 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	38,685,538 - 38,712,277 (+)	Ensembl				GRCr8
mRatBN7.2	12	33,024,596 - 33,051,399 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,024,650 - 33,051,393 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	34,203,080 - 34,228,179 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,814,434 - 34,839,530 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,866,322 - 33,891,419 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,459,816 - 38,482,903 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,459,832 - 38,484,512 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	40,340,915 - 40,364,786 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	34,163,538 - 34,189,019 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	34,710,002 - 34,735,096 (+)	NCBI		Celera
RGSC_v3.1	12	34,026,939 - 34,054,016 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Desbuquois dysplasia (ISO)

Hermansky-Pudlak syndrome (ISS)

Mucopolysaccharidosis-Plus Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

Dibutyl phosphate (ISO)

dimethyl sulfoxide (ISO)

doxorubicin (ISO)

ethanol (ISO)

folic acid (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (EXP,ISO)

lead(0) (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

thiram (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

vinclozolin (EXP)

zinc protoporphyrin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome maturation (IEA,ISO)

autophagosome-lysosome fusion (IEA,ISO)

biological_process (ND)

endosome to lysosome transport (IEA,ISO)

intracellular protein transport (IBA)

lysosome localization (IEA,ISO)

melanosome localization (IEA,ISO)

pigmentation (ISO)

platelet formation (ISO)

protein transport (IEA)

regulation of developmental pigmentation (ISO)

regulation of lysosomal lumen pH (IEA,ISO,ISS)

vesicle-mediated transport (IBA,IEA,ISO)

Cellular Component

AP-3 adaptor complex (IEA,ISO)

autophagosome (IEA,ISO,ISS)

clathrin complex (IEA,ISO)

clathrin-coated vesicle (IEA)

CORVET complex (IBA,IEA,ISO)

cytoplasmic vesicle (IEA)

early endosome (IEA,ISO)

HOPS complex (IEA,ISO)

late endosome (IEA,ISO)

late endosome membrane (IEA)

lysosomal membrane (IEA,ISO)

lysosome (IBA,IEA,ISO,ISS)

perinuclear region of cytoplasm (IEA,ISO)

Molecular Function

molecular adaptor activity (IEA,ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Molecular characterization of mammalian homologues of class C Vps proteins that interact with syntaxin-7.	Kim BY, etal., J Biol Chem. 2001 Aug 3;276(31):29393-402. Epub 2001 May 29.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Mammalian homologues of yeast vacuolar protein sorting (vps) genes implicated in Golgi-to-lysosome trafficking.	Pevsner J, etal., Gene 1996 Dec 12;183(1-2):7-14.
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:4777306	PMID:12477932	PMID:12538872	PMID:15790593	PMID:17897319	PMID:19109425	PMID:21411634	PMID:23901104	PMID:24554770	PMID:25266290	PMID:25783203	PMID:27628032
PMID:28013294

Genomics

Comparative Map Data

Vps33a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,685,484 - 38,710,668 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	38,685,538 - 38,712,277 (+)	Ensembl				GRCr8
mRatBN7.2	12	33,024,596 - 33,051,399 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,024,650 - 33,051,393 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	34,203,080 - 34,228,179 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,814,434 - 34,839,530 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,866,322 - 33,891,419 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,459,816 - 38,482,903 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,459,832 - 38,484,512 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	40,340,915 - 40,364,786 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	34,163,538 - 34,189,019 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	34,710,002 - 34,735,096 (+)	NCBI		Celera
RGSC_v3.1	12	34,026,939 - 34,054,016 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

VPS33A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	122,229,564 - 122,266,494 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	122,229,564 - 122,266,502 (-)	Ensembl			hg38	GRCh38
GRCh37	12	122,714,111 - 122,751,041 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	121,282,047 - 121,317,021 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	121,240,974 - 121,275,897	NCBI
Celera	12	122,305,460 - 122,340,912 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	119,676,859 - 119,711,913 (-)	NCBI		HuRef
CHM1_1	12	122,684,386 - 122,719,360 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	122,225,350 - 122,262,283 (-)	NCBI		T2T-CHM13v2.0

Vps33a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	123,666,820 - 123,711,104 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	123,666,722 - 123,711,101 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	123,528,757 - 123,573,043 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	123,528,659 - 123,573,038 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	123,978,766 - 124,023,024 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	123,789,720 - 123,833,624 (-)	NCBI		MGSCv36	mm8
Celera	5	120,615,562 - 120,647,244 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.03	NCBI

Vps33a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	6,332,366 - 6,353,834 (+)	Ensembl
ChiLan1.0	NW_004955482	6,333,282 - 6,352,369 (+)	NCBI	ChiLan1.0	ChiLan1.0

VPS33A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	130,322,804 - 130,358,825 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	130,319,726 - 130,354,330 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	119,831,693 - 119,868,132 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	123,200,964 - 123,236,132 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	123,201,663 - 123,236,019 (-)	Ensembl			panPan2	panpan1.1

VPS33A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	7,090,669 - 7,119,913 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	7,250,848 - 7,282,200 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	7,342,147 - 7,373,504 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	7,342,183 - 7,373,504 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	7,274,298 - 7,305,672 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,365,289 - 7,396,615 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	7,320,923 - 7,352,308 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Vps33a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	157,221,701 - 157,252,173 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	2,227,253 - 2,257,722 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	2,227,305 - 2,257,725 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VPS33A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	30,469,070 - 30,495,470 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	30,469,003 - 30,496,626 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	32,196,959 - 32,221,702 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VPS33A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	117,585,325 - 117,618,713 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	117,582,781 - 117,615,743 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	127,711,627 - 127,745,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vps33a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	22,461,346 - 22,478,867 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	22,458,098 - 22,478,735 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Vps33a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	30,290,921 - 30,317,370 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Vps33a
185 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	172
Count of miRNA genes:	126
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000065264
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	34243475	43352593	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

RH127390

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,051,007 - 33,051,203 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,484,127 - 38,484,322	NCBI	Rnor6.0
Rnor_5.0	12	40,366,010 - 40,366,205	UniSTS	Rnor5.0
RGSC_v3.4	12	34,190,243 - 34,190,438	UniSTS	RGSC3.4
Celera	12	34,736,320 - 34,736,515	UniSTS
RH 3.4 Map	12	573.82	UniSTS
Cytogenetic Map	12	q16	UniSTS

AW554476

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,050,424 - 33,050,549 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,483,544 - 38,483,668	NCBI	Rnor6.0
Rnor_5.0	12	40,365,427 - 40,365,551	UniSTS	Rnor5.0
RGSC_v3.4	12	34,189,660 - 34,189,784	UniSTS	RGSC3.4
Celera	12	34,735,737 - 34,735,861	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000080785 ⟹ ENSRNOP00000075460

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,685,538 - 38,712,277 (+)	Ensembl
mRatBN7.2 Ensembl	12	33,024,650 - 33,051,393 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,465,130 - 38,484,512 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090343 ⟹ ENSRNOP00000073489

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,685,538 - 38,712,277 (+)	Ensembl
mRatBN7.2 Ensembl	12	33,024,650 - 33,051,393 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,459,832 - 38,482,600 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000145599 ⟹ ENSRNOP00000105957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	38,685,538 - 38,712,277 (+)	Ensembl

RefSeq Acc Id:

NM_022961 ⟹ NP_075250

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	38,685,524 - 38,710,668 (+)	NCBI
mRatBN7.2	12	33,024,636 - 33,049,784 (+)	NCBI
Rnor_6.0	12	38,459,816 - 38,482,903 (+)	NCBI
Rnor_5.0	12	40,340,915 - 40,364,786 (+)	NCBI
RGSC_v3.4	12	34,163,538 - 34,189,019 (+)	RGD
Celera	12	34,710,002 - 34,735,096 (+)	RGD

Sequence:

show sequence

CGGGTGGTGGAGCAAGATGGCGGCTCACCTGTCATACGGGCGAGTGAACCTGAACGTGCTGCGC
GAGGCGGTGCGTCGGGAGCTGCGCGAGTTTCTGGACAAGTGCGCTGGGAGCAAGGCAATAGTGT
GGGATGAATACTTAACAGGACCGTTTGGACTGATTGCACAGTACTCACTACTAAAGGAACATGA
AGTGGAAAAAATGTTCACCCTCAAAGGAAGTCGTTTGCCAGCGGCTGATGTCAAGAATATCATT
TTTTTGGTCAGACCCAGGCTAGAATTAATGGATATGATTGCCGAGAACGTACTCAGTGAGGACA
GGCGTGGCCCTACCAGGGATTTCCATATTTTGTTTGTGCCTCGTCGGAGCCTACTGTGTGAGCA
AAGGCTGAAGGACCTGGGTGTGTTGGGATCCTTTATTTATCGAGAGGAGTACAGTTTAGATCTC
ATTCCATTTGATGGGGACCTCTTATCCATGGAGTCAGAGAGCGCTTTCAAAGAATGCTACCTTG
AAGGCGACCAGACAAGCCTGTACCACGCAGCCAAGGGGCTGATGACCCTGCAGGCGCTGTATGG
AACTATCCCCCAGATCTTTGGGAAAGGAGAGTGTGCTCGGCAAGTGGCCAATATGATGGTCAGG
ATGAAAAGGGAGTTTACAGGCAGCCAAAACTCAGTGTTCCCCGTGTTTGATAACCTCTTACTGC
TTGATCGCAACGTGGATCTGCTGACGCCGCTCGCCTCCCAGCTCACGTACGAAGGACTCATCGA
CGAGATTTACGGCATTCAGAACAGTTATGTGAAGTTACCTCCAGAGAAATTTGCACCCAAGAAG
CAGGGCGGTGGTGGCGGGAAGGACCTTCCCACAGAGGCAAAGAAGCTTCAGCTCAACTCCGCAG
AGGAACTCTATGCCGAGATCCGAGACAAGAACTTCAACGCTGTGGGCTCCGTGCTCAGCAAGAA
GGCGAAGATCATCTCCGCGGCCTTTGAGGAGCGACACAATGCTAAGACGGTTGGAGAGATCAAG
CAATTCGTCTCCCAGCTTCCCCACATGCAGGCGGCCAGGGGGTCGCTTGCCAACCACACCTCAA
TTGCAGAGTTAATCAAAGACGTCACCACTTCTGAAGACTTCTTTGATAAGTTGACGGTGGAGCA
GGAGTTCATGTCCGGGATAGACACCGATAAGGTCAACAATTACATCGAGGACTGCATTGCCCAA
AAGCACCCGCTCATCAAGGTCCTGAGATTGGTTTGCCTCCAGTCTGTGTGCAACAGTGGGCTCA
AGCAGAAGGTTCTGGACTACTACAAAAGGGAAATTCTCCAGACCTACGGCTATGAGCACATACT
GACCCTGAACAACCTGGAGAAGGCCGGCCTGCTAAAGGCTCAGACAGGGGGCAGAAACAACTAC
CCAACGATTCGGAAAACATTACGCCTCTGGATGGACGATGTCAATGAACAAAACCCCACAGACA
TATCCTACGTGTACAGTGGTTACGCACCACTCAGCGTGCGACTCGCCCAGCTCCTTTCTCGGCC
AGGTTGGAGGAGCATCGAGGAGGTTCTCCGCATTCTCCCAGGGCCCCACTTTGAAGAAAGGCAG
CCACTGCCCACCGGGCTGCAGAAGAAACGCCAGCCAGGAGAAAACAGAGTCACACTGGTGTTTT
TCCTCGGGGGCGTCACCTTTGCTGAAATCGCAGCCCTGCGTTTTCTCTCCCAGCTGGAAGACGG
AGGCACAGAGTATGTAATTGCGACCACTAAACTGATAAATGGAAGCAGCTGGCTAGAAGCTCTC
ATGGAAAAGCCTTTCTAGGCTGTCAGAGGGGACAGTGAGCTGCCCCTGAGAACGTGTTGCCCAA
AGGACATAAAGCCAGGAGCATGGAGGCAACGGGATTGTGTTCCTTCCTGCTCCTCTCTGTGCTC
CTAAACCCTGAAGAAGGGAGGGTCGGCCTGGGTAAGGACACAATGAGCTGGGCGTGGCGGCTCA
TGCCTAGAACTCCTCCACTTAAGAGACACAGGCAGGAGGATCGCTGCAAGTTTGGGACAGCTGG
GGCTACATAGCGAGTTCCAGGCAAAAGCCCTCCCTTCCAGAAATAAAGGAGATCCTGTTTCGGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039089725 ⟹ XP_038945653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	38,685,484 - 38,706,897 (+)	NCBI
mRatBN7.2	12	33,024,596 - 33,045,954 (+)	NCBI

RefSeq Acc Id:

XM_039089726 ⟹ XP_038945654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	38,685,484 - 38,698,855 (+)	NCBI
mRatBN7.2	12	33,024,596 - 33,036,750 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_075250	(Get FASTA)	NCBI Sequence Viewer
	XP_038945653	(Get FASTA)	NCBI Sequence Viewer
	XP_038945654	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05753	(Get FASTA)	NCBI Sequence Viewer
	EDM13629	(Get FASTA)	NCBI Sequence Viewer
	EDM13630	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073489
GenBank Protein	Q63615	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_075250 ⟸ NM_022961

- UniProtKB:

Q63615 (UniProtKB/Swiss-Prot), Q3KRF0 (UniProtKB/TrEMBL), A0A0G2K5N1 (UniProtKB/TrEMBL), A0A9K3Y802 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMF
TLKGSRLPAADVKNIIFLVRPRLELMDMIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDL
GVLGSFIYREEYSLDLIPFDGDLLSMESESAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQI
FGKGECARQVANMMVRMKREFTGSQNSVFPVFDNLLLLDRNVDLLTPLASQLTYEGLIDEIYGI
QNSYVKLPPEKFAPKKQGGGGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIIS
AAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSG
IDTDKVNNYIEDCIAQKHPLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLNNL
EKAGLLKAQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSI
EEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLVFFLGGVTFAEIAALRFLSQLEDGGTEYV
IATTKLINGSSWLEALMEKPF

hide sequence

Ensembl Acc Id:

ENSRNOP00000075460 ⟸ ENSRNOT00000080785

Ensembl Acc Id:

ENSRNOP00000073489 ⟸ ENSRNOT00000090343

RefSeq Acc Id:	XP_038945653 ⟸ XM_039089725
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038945654 ⟸ XM_039089726
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000105957 ⟸ ENSRNOT00000145599

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63615-F1-model_v2	AlphaFold	Q63615	1-597	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698634

Promoter ID:

EPDNEW_R9154

Type:

multiple initiation site

Name:

Vps33a_1

Description:

VPS33A CORVET/HOPS core subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	38,459,799 - 38,459,859	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620643	AgrOrtholog
BioCyc Gene	G2FUF-19316	BioCyc
Ensembl Genes	ENSRNOG00000056889	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000090343	ENTREZGENE
Gene3D-CATH	1.25.40.850	UniProtKB/Swiss-Prot
	3.40.50.1910	UniProtKB/Swiss-Prot
	3.40.50.2060	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5599123	IMAGE-MGC_LOAD
InterPro	Sec-1-like_dom1	UniProtKB/Swiss-Prot
	Sec-1-like_dom2	UniProtKB/Swiss-Prot
	Sec1-like	UniProtKB/Swiss-Prot
	Sec1-like_sf	UniProtKB/Swiss-Prot
	VPS33_dom3b	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124527	IMAGE-MGC_LOAD
NCBI Gene	65081	ENTREZGENE
PANTHER	PTHR11679	UniProtKB/Swiss-Prot
Pfam	Sec1	UniProtKB/Swiss-Prot
PhenoGen	Vps33a	PhenoGen
RatGTEx	ENSRNOG00000056889	RatGTEx
Superfamily-SCOP	SSF56815	UniProtKB/Swiss-Prot
UniProt	A0A0G2K5N1	ENTREZGENE
	A0A0G2KAN2_RAT	UniProtKB/TrEMBL
	A0A9K3Y802	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LK06_RAT	UniProtKB/TrEMBL
	Q3KRF0	ENTREZGENE, UniProtKB/TrEMBL
	Q63615	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-02	Vps33a	VPS33A core subunit of CORVET and HOPS complexes	Vps33a	VPS33A CORVET/HOPS core subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-25	Vps33a	VPS33A CORVET/HOPS core subunit	Vps33a	vacuolar protein sorting 33 homolog A (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Vps33a	vacuolar protein sorting 33 homolog A (S. cerevisiae)	Vps33a	vacuolar protein sorting 33A (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Vps33a	vacuolar protein sorting 33A (yeast)		vacuolar protein sorting protein 33a	Name updated	1299863	APPROVED
2002-08-07	Vps33a	vacuolar protein sorting protein 33a			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	involved in vesicle trafficking	730029

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM