Symbol:
Mlxipl (Ensembl: AABR07035839.1)
Name:
MLX interacting protein-like
RGD ID:
620400
Description:
Enables DNA-binding transcription factor activity; protein kinase binding activity; and sequence-specific DNA binding activity. Involved in several processes, including cellular response to glucose stimulus; fatty acid homeostasis; and regulation of nucleobase-containing compound metabolic process. Located in cytosol and nucleus. Biomarker of end stage renal disease; kidney disease; metabolic dysfunction-associated steatohepatitis; metabolic dysfunction-associated steatotic liver disease; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in coronary artery disease and myocardial infarction. Orthologous to human MLXIPL (MLX interacting protein like); PARTICIPATES IN glycolysis/gluconeogenesis pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bHLHd14; carbohydrate-responsive element-binding protein; ChREBP; class D basic helix-loop-helix protein 14; MLX interactor; MLX-interacting protein-like; Wbscr14; Williams-Beuren syndrome chromosomal region 14 protein; Williams-Beuren syndrome chromosome region 14 homolog; Williams-Beuren syndrome chromosome region 14 homolog (human); WS basic-helix-loop-helix leucine zipper protein; WS-bHLH
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,178,158 - 27,213,675 (-) NCBI GRCr8 mRatBN7.2 12 21,541,608 - 21,577,120 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 21,543,576 - 21,577,112 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 22,683,529 - 22,719,209 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,295,853 - 23,331,535 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,362,318 - 22,398,011 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 24,590,645 - 24,619,639 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 12 26,588,220 - 26,620,779 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 12 23,305,691 - 23,340,439 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mlxipl Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MLXIPL mRNA] CTD PMID:31150632 Mlxipl Rat (+/-)-Aegeline multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of MLXIPL mRNA CTD PMID:28843594 Mlxipl Rat (aminooxy)acetic acid multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Aminooxyacetic Acid co-treated with Xylitol] results in increased expression of MLXIPL mRNA alternative form CTD PMID:31974165 Mlxipl Rat (RS)-coclaurine multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of MLXIPL mRNA CTD PMID:28843594 Mlxipl Rat (RS)-norcoclaurine multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of MLXIPL mRNA CTD PMID:28843594 Mlxipl Rat (S)-coclaurine multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of MLXIPL mRNA CTD PMID:28843594 Mlxipl Rat 1,2-dimethylhydrazine decreases expression ISO Mlxipl (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MLXIPL mRNA CTD PMID:22206623 Mlxipl Rat 17alpha-ethynylestradiol affects expression ISO Mlxipl (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of MLXIPL mRNA CTD PMID:17555576 Mlxipl Rat 17alpha-ethynylestradiol decreases expression ISO Mlxipl (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of MLXIPL mRNA CTD PMID:17942748 Mlxipl Rat 17beta-estradiol multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of MLXIPL mRNA CTD PMID:30165855 Mlxipl Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MLXIPL mRNA CTD PMID:32145629 and PMID:35192832 Mlxipl Rat 17beta-estradiol decreases expression ISO Mlxipl (Mus musculus) 6480464 Estradiol results in decreased expression of MLXIPL mRNA CTD PMID:39298647 Mlxipl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mlxipl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MLXIPL mRNA CTD PMID:17942748 Mlxipl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in decreased expression of MLXIPL mRNA CTD PMID:29704546 Mlxipl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mlxipl (Mus musculus) 6480464 Dietary Fats promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of MLXIPL mRNA] and Tetrachlorodibenzodioxin inhibits the reaction [Dietary Fats results in increased expression of MLXIPL mRNA] CTD PMID:27713108 Mlxipl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mlxipl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MLXIPL mRNA CTD PMID:26377647 Mlxipl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mlxipl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MLXIPL mRNA CTD PMID:26290441 more ... Mlxipl Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Mlxipl (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Mlxipl Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of MLXIPL mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of MLXIPL mRNA CTD PMID:28628672 Mlxipl Rat 4,4'-diaminodiphenylmethane increases expression ISO Mlxipl (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MLXIPL mRNA CTD PMID:18648102 Mlxipl Rat 4,4'-sulfonyldiphenol increases expression ISO MLXIPL (Homo sapiens) 6480464 bisphenol S results in increased expression of MLXIPL mRNA CTD PMID:27685785 Mlxipl Rat 4,4'-sulfonyldiphenol decreases methylation ISO Mlxipl (Mus musculus) 6480464 bisphenol S results in decreased methylation of MLXIPL gene CTD PMID:31683443 Mlxipl Rat 4,4'-sulfonyldiphenol increases methylation ISO Mlxipl (Mus musculus) 6480464 bisphenol S results in increased methylation of MLXIPL exon CTD PMID:33297965 Mlxipl Rat 4,4'-sulfonyldiphenol decreases expression ISO Mlxipl (Mus musculus) 6480464 bisphenol S results in decreased expression of MLXIPL mRNA CTD PMID:39298647 Mlxipl Rat 4-hydroxyphenyl retinamide increases expression ISO Mlxipl (Mus musculus) 6480464 Fenretinide results in increased expression of MLXIPL mRNA CTD PMID:28973697 Mlxipl Rat 5-aza-2'-deoxycytidine affects expression ISO MLXIPL (Homo sapiens) 6480464 Decitabine affects the expression of MLXIPL mRNA CTD PMID:23300844 Mlxipl Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime increases expression ISO MLXIPL (Homo sapiens) 6480464 6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:27180240 and PMID:30611723 Mlxipl Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Mlxipl Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MLXIPL mRNA CTD PMID:30047161 Mlxipl Rat actinomycin D multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of MLXIPL mRNA CTD PMID:38460933 Mlxipl Rat aflatoxin B1 affects expression ISO MLXIPL (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MLXIPL protein CTD PMID:20106945 Mlxipl Rat aflatoxin B1 decreases expression ISO MLXIPL (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MLXIPL mRNA CTD PMID:22100608 and PMID:27153756 Mlxipl Rat aflatoxin B1 increases expression ISO Mlxipl (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of MLXIPL mRNA CTD PMID:19770486 Mlxipl Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of MLXIPL protein CTD PMID:16644726 and PMID:16790840 Mlxipl Rat aldehydo-D-glucose increases expression ISO Mlxipl (Mus musculus) 6480464 Glucose results in increased expression of MLXIPL mRNA alternative form CTD PMID:31974165 Mlxipl Rat aldehydo-D-glucose multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Glucose co-treated with S 4048] results in increased expression of MLXIPL mRNA and Glucose promotes the reaction [MLXIPL protein binds to TUG1 promoter] CTD PMID:31974165 and PMID:32467232 Mlxipl Rat amiodarone decreases expression ISO Mlxipl (Mus musculus) 6480464 Amiodarone results in decreased expression of MLXIPL mRNA CTD PMID:28962527 Mlxipl Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of MLXIPL mRNA CTD PMID:30047161 Mlxipl Rat arsenite(3-) decreases expression ISO Mlxipl (Mus musculus) 6480464 arsenite results in decreased expression of MLXIPL protein CTD PMID:37955338 Mlxipl Rat atorvastatin calcium multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Fructose affects the localization of and results in increased activity of MLXIPL protein] more ... CTD PMID:19053045 and PMID:21122807 Mlxipl Rat atrazine multiple interactions ISO Mlxipl (Mus musculus) 6480464 Atrazine promotes the reaction [[lard co-treated with Cholesterol co-treated with Sucrose] results in increased expression of MLXIPL mRNA] CTD PMID:24440342 Mlxipl Rat benzo[a]pyrene affects expression ISO Mlxipl (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of MLXIPL mRNA CTD PMID:22342234 Mlxipl Rat benzo[a]pyrene decreases expression ISO MLXIPL (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MLXIPL mRNA CTD PMID:32234424 Mlxipl Rat benzo[a]pyrene affects methylation ISO MLXIPL (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MLXIPL promoter CTD PMID:27901495 Mlxipl Rat benzo[a]pyrene decreases expression ISO Mlxipl (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MLXIPL mRNA CTD PMID:19770486 Mlxipl Rat benzo[a]pyrene multiple interactions ISO Mlxipl (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to MLXIPL promoter] CTD PMID:19654925 Mlxipl Rat beta-lapachone decreases expression ISO MLXIPL (Homo sapiens) 6480464 beta-lapachone results in decreased expression of MLXIPL mRNA CTD PMID:38218311 Mlxipl Rat bexarotene multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Bexarotene co-treated with GW 3965] results in decreased expression of MLXIPL mRNA and [Bexarotene co-treated with T0901317] results in decreased expression of MLXIPL mRNA CTD PMID:32123961 Mlxipl Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Mlxipl (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MLXIPL mRNA CTD PMID:39150890 Mlxipl Rat bis(2-ethylhexyl) phthalate increases methylation ISO Mlxipl (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of MLXIPL gene more ... CTD PMID:32864567 Mlxipl Rat bisphenol A affects expression ISO Mlxipl (Mus musculus) 6480464 bisphenol A affects the expression of MLXIPL mRNA and bisphenol A affects the expression of MLXIPL protein CTD PMID:21932408 Mlxipl Rat bisphenol A increases expression ISO Mlxipl (Mus musculus) 6480464 bisphenol A results in increased expression of MLXIPL mRNA CTD PMID:34585602 Mlxipl Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MLXIPL mRNA CTD PMID:32145629 Mlxipl Rat bisphenol A affects expression ISO MLXIPL (Homo sapiens) 6480464 bisphenol A affects the expression of MLXIPL mRNA CTD PMID:30903817 Mlxipl Rat bisphenol A affects methylation ISO Mlxipl (Mus musculus) 6480464 bisphenol A affects the methylation of MLXIPL promoter CTD PMID:27334623 Mlxipl Rat bisphenol A multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of MLXIPL mRNA CTD PMID:28628672 Mlxipl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MLXIPL mRNA CTD PMID:25181051 and PMID:35192832 Mlxipl Rat bisphenol A increases expression ISO MLXIPL (Homo sapiens) 6480464 bisphenol A results in increased expression of MLXIPL mRNA CTD PMID:25619500 Mlxipl Rat bisphenol F decreases expression ISO Mlxipl (Mus musculus) 6480464 bisphenol F results in decreased expression of MLXIPL mRNA CTD PMID:38685157 Mlxipl Rat Butylbenzyl phthalate multiple interactions ISO Mlxipl (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MLXIPL mRNA CTD PMID:39150890 Mlxipl Rat cadmium atom multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MLXIPL mRNA CTD PMID:35301059 Mlxipl Rat cadmium dichloride increases expression ISO Mlxipl (Mus musculus) 6480464 Cadmium Chloride results in increased expression of MLXIPL mRNA CTD PMID:26352046 Mlxipl Rat cadmium dichloride multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MLXIPL mRNA CTD PMID:35301059 Mlxipl Rat caffeine multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of MLXIPL mRNA CTD PMID:28843594 Mlxipl Rat caffeine increases phosphorylation ISO MLXIPL (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of MLXIPL protein CTD PMID:35688186 Mlxipl Rat carbon nanotube decreases expression ISO Mlxipl (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Mlxipl Rat cetirizine decreases expression ISO Mlxipl (Mus musculus) 6480464 Cetirizine results in decreased expression of MLXIPL mRNA CTD PMID:24852568 Mlxipl Rat cetirizine multiple interactions ISO Mlxipl (Mus musculus) 6480464 APOE gene mutant form inhibits the reaction [Cetirizine results in decreased expression of MLXIPL mRNA] CTD PMID:24852568 Mlxipl Rat CGP 52608 multiple interactions ISO MLXIPL (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MLXIPL gene] CTD PMID:28238834 Mlxipl Rat chlordecone increases expression ISO Mlxipl (Mus musculus) 6480464 Chlordecone results in increased expression of MLXIPL mRNA CTD PMID:29980752 Mlxipl Rat chloroethene multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Vinyl Chloride co-treated with Dietary Fats co-treated with Dietary Carbohydrates] results in increased expression of MLXIPL mRNA CTD PMID:37061008 Mlxipl Rat chloroethene increases expression ISO Mlxipl (Mus musculus) 6480464 Vinyl Chloride results in increased expression of MLXIPL mRNA CTD PMID:37061008 Mlxipl Rat chlorpyrifos decreases expression ISO Mlxipl (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of MLXIPL mRNA CTD PMID:37019170 Mlxipl Rat cholesterol multiple interactions ISO Mlxipl (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose] results in increased expression of MLXIPL mRNA and Atrazine promotes the reaction [[lard co-treated with Cholesterol co-treated with Sucrose] results in increased expression of MLXIPL mRNA] CTD PMID:24440342 Mlxipl Rat choline multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of MLXIPL mRNA CTD PMID:22872676 Mlxipl Rat ciguatoxin CTX1B affects expression ISO Mlxipl (Mus musculus) 6480464 Ciguatoxins affects the expression of MLXIPL mRNA CTD PMID:18353800 Mlxipl Rat cisplatin affects expression ISO MLXIPL (Homo sapiens) 6480464 Cisplatin affects the expression of MLXIPL mRNA CTD PMID:23300844 Mlxipl Rat cisplatin increases expression ISO MLXIPL (Homo sapiens) 6480464 Cisplatin results in increased expression of MLXIPL mRNA CTD PMID:27392435 and PMID:27594783 Mlxipl Rat cisplatin multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of MLXIPL mRNA CTD PMID:27392435 Mlxipl Rat copper(II) sulfate decreases expression ISO MLXIPL (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MLXIPL mRNA CTD PMID:19549813 Mlxipl Rat CU-O LINKAGE increases expression ISO MLXIPL (Homo sapiens) 6480464 cupric oxide results in increased expression of MLXIPL mRNA CTD PMID:22077320 Mlxipl Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MLXIPL mRNA CTD PMID:27523638 Mlxipl Rat cyclosporin A decreases expression ISO MLXIPL (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MLXIPL mRNA CTD PMID:20106945 and PMID:25562108 Mlxipl Rat cyclosporin A decreases methylation ISO MLXIPL (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of MLXIPL promoter CTD PMID:27989131 Mlxipl Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of MLXIPL protein CTD PMID:16644726 and PMID:16790840 Mlxipl Rat D-glucose increases expression ISO Mlxipl (Mus musculus) 6480464 Glucose results in increased expression of MLXIPL mRNA alternative form CTD PMID:31974165 Mlxipl Rat D-glucose multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Glucose co-treated with S 4048] results in increased expression of MLXIPL mRNA and Glucose promotes the reaction [MLXIPL protein binds to TUG1 promoter] CTD PMID:31974165 and PMID:32467232 Mlxipl Rat dexamethasone increases expression ISO MLXIPL (Homo sapiens) 6480464 Dexamethasone results in increased expression of MLXIPL mRNA CTD PMID:25047013 Mlxipl Rat dexamethasone increases expression ISO Mlxipl (Mus musculus) 6480464 Dexamethasone results in increased expression of MLXIPL mRNA alternative form CTD PMID:31053639 Mlxipl Rat dexamethasone multiple interactions ISO Mlxipl (Mus musculus) 6480464 [ANGPTL4 gene mutant form results in increased susceptibility to Dexamethasone] which results in decreased expression of MLXIPL mRNA and ANGPTL4 gene mutant form inhibits the reaction [Dexamethasone results in decreased expression of MLXIPL mRNA alternative form] CTD PMID:31053639 Mlxipl Rat dexamethasone multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of MLXIPL mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of MLXIPL mRNA CTD PMID:28628672 Mlxipl Rat dibutyl phthalate multiple interactions ISO Mlxipl (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MLXIPL mRNA CTD PMID:39150890 Mlxipl Rat dicrotophos increases expression ISO MLXIPL (Homo sapiens) 6480464 dicrotophos results in increased expression of MLXIPL mRNA CTD PMID:28302478 Mlxipl Rat diethyl phthalate multiple interactions ISO Mlxipl (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MLXIPL mRNA CTD PMID:39150890 Mlxipl Rat difenoconazole multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [difenoconazole co-treated with fludioxonil] results in decreased expression of MLXIPL mRNA CTD PMID:33575850 Mlxipl Rat difenoconazole decreases expression ISO Mlxipl (Mus musculus) 6480464 difenoconazole results in decreased expression of MLXIPL mRNA CTD PMID:34425431 Mlxipl Rat diisobutyl phthalate multiple interactions ISO Mlxipl (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MLXIPL mRNA CTD PMID:39150890 Mlxipl Rat diisononyl phthalate multiple interactions ISO Mlxipl (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MLXIPL mRNA CTD PMID:39150890 Mlxipl Rat dioxygen multiple interactions ISO Mlxipl (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MLXIPL mRNA CTD PMID:30529165 Mlxipl Rat disodium selenite decreases expression ISO Mlxipl (Mus musculus) 6480464 Sodium Selenite results in decreased expression of MLXIPL mRNA CTD PMID:23274088 Mlxipl Rat dorsomorphin multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MLXIPL mRNA CTD PMID:27188386 Mlxipl Rat enilconazole decreases expression ISO MLXIPL (Homo sapiens) 6480464 enilconazole results in decreased expression of MLXIPL mRNA CTD PMID:32201337 Mlxipl Rat entinostat increases expression ISO MLXIPL (Homo sapiens) 6480464 entinostat results in increased expression of MLXIPL mRNA CTD PMID:26272509 Mlxipl Rat entinostat multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MLXIPL mRNA CTD PMID:27188386 Mlxipl Rat ethanol multiple interactions ISO Mlxipl (Mus musculus) 6480464 pirinixic acid inhibits the reaction [Ethanol results in increased expression of MLXIPL mRNA] CTD PMID:18620774 Mlxipl Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of MLXIPL mRNA and Ethanol results in increased expression of MLXIPL protein CTD PMID:27989594 Mlxipl Rat ethanol multiple interactions EXP 6480464 salvianolic acid B inhibits the reaction [Ethanol results in increased expression of MLXIPL mRNA] more ... CTD PMID:27989594 Mlxipl Rat ethanol increases expression ISO Mlxipl (Mus musculus) 6480464 Ethanol results in increased expression of MLXIPL mRNA CTD PMID:18620774 Mlxipl Rat ethanol increases activity ISO Mlxipl (Mus musculus) 6480464 Ethanol results in increased activity of MLXIPL protein CTD PMID:18620774 Mlxipl Rat farnesol multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Farnesol analog co-treated with Oleic Acid] results in decreased expression of MLXIPL mRNA CTD PMID:30611723 Mlxipl Rat fenthion decreases expression ISO Mlxipl (Mus musculus) 6480464 Fenthion results in decreased expression of MLXIPL mRNA CTD PMID:34813904 Mlxipl Rat Fexofenadine hydrochloride multiple interactions ISO Mlxipl (Mus musculus) 6480464 APOE gene mutant form inhibits the reaction [fexofenadine results in decreased expression of MLXIPL mRNA] CTD PMID:24852568 Mlxipl Rat Fexofenadine hydrochloride decreases expression ISO Mlxipl (Mus musculus) 6480464 fexofenadine results in decreased expression of MLXIPL mRNA CTD PMID:24852568 Mlxipl Rat fludioxonil multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [difenoconazole co-treated with fludioxonil] results in decreased expression of MLXIPL mRNA and [tebuconazole co-treated with fludioxonil] results in decreased expression of MLXIPL mRNA CTD PMID:33575850 Mlxipl Rat fludioxonil decreases expression ISO MLXIPL (Homo sapiens) 6480464 fludioxonil results in decreased expression of MLXIPL mRNA CTD PMID:33575850 Mlxipl Rat folic acid multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of MLXIPL mRNA CTD PMID:22872676 Mlxipl Rat fructose multiple interactions EXP 6480464 Atorvastatin inhibits the reaction [Fructose affects the localization of and results in increased activity of MLXIPL protein] more ... CTD PMID:19053045 and PMID:21122807 Mlxipl Rat fructose decreases expression ISO Mlxipl (Mus musculus) 6480464 Fructose results in decreased expression of MLXIPL mRNA CTD PMID:28123933 Mlxipl Rat fructose increases expression ISO Mlxipl (Mus musculus) 6480464 Fructose results in increased expression of MLXIPL mRNA alternative form CTD PMID:28123933 Mlxipl Rat fructose multiple interactions ISO Mlxipl (Mus musculus) 6480464 FGF21 gene mutant form inhibits the reaction [Fructose results in increased expression of MLXIPL mRNA alternative form] more ... CTD PMID:28123933 Mlxipl Rat fructose increases activity EXP 6480464 Fructose results in increased activity of MLXIPL protein CTD PMID:19799862 Mlxipl Rat fructose increases expression EXP 6480464 Fructose results in increased expression of MLXIPL mRNA and Fructose results in increased expression of MLXIPL protein CTD PMID:18346472 and PMID:21122807 Mlxipl Rat furan decreases expression EXP 6480464 furan results in decreased expression of MLXIPL mRNA CTD PMID:26194646 Mlxipl Rat glucose increases expression EXP 6480464 Glucose results in increased expression of MLXIPL protein CTD PMID:16644726 and PMID:16790840 Mlxipl Rat glucose increases expression ISO Mlxipl (Mus musculus) 6480464 Glucose results in increased expression of MLXIPL mRNA alternative form CTD PMID:31974165 Mlxipl Rat glucose multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Glucose co-treated with S 4048] results in increased expression of MLXIPL mRNA and Glucose promotes the reaction [MLXIPL protein binds to TUG1 promoter] CTD PMID:31974165 and PMID:32467232 Mlxipl Rat glyphosate decreases expression ISO Mlxipl (Mus musculus) 6480464 Glyphosate results in decreased expression of MLXIPL protein CTD PMID:37208198 Mlxipl Rat GW 3965 multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Bexarotene co-treated with GW 3965] results in decreased expression of MLXIPL mRNA CTD PMID:32123961 Mlxipl Rat GW 3965 decreases expression ISO MLXIPL (Homo sapiens) 6480464 GW 3965 results in decreased expression of MLXIPL mRNA CTD PMID:32123961 Mlxipl Rat GW 4064 decreases expression ISO MLXIPL (Homo sapiens) 6480464 GW 4064 results in decreased expression of MLXIPL mRNA CTD PMID:30611723 Mlxipl Rat GW 4064 multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [GW 4064 co-treated with Oleic Acid] results in decreased expression of MLXIPL mRNA CTD PMID:30611723 Mlxipl Rat GW 7647 multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [GW 7647 co-treated with Oleic Acid] results in decreased expression of MLXIPL mRNA CTD PMID:30611723 Mlxipl Rat imidacloprid increases expression ISO Mlxipl (Mus musculus) 6480464 imidacloprid results in increased expression of MLXIPL mRNA CTD PMID:33487623 Mlxipl Rat indometacin multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of MLXIPL mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of MLXIPL mRNA CTD PMID:28628672 Mlxipl Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of MLXIPL mRNA CTD PMID:20097248 Mlxipl Rat L-methionine multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of MLXIPL mRNA CTD PMID:22872676 Mlxipl Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MLXIPL mRNA CTD PMID:30047161 Mlxipl Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of MLXIPL mRNA CTD PMID:26092479 Mlxipl Rat monosodium L-glutamate multiple interactions EXP 6480464 Taurine inhibits the reaction [Sodium Glutamate results in decreased expression of MLXIPL mRNA] CTD PMID:26092479 Mlxipl Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Atorvastatin inhibits the reaction [Fructose results in increased activity of MLXIPL protein]] CTD PMID:19053045 Mlxipl Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of MLXIPL mRNA CTD PMID:24136188 Mlxipl Rat nicotinamide multiple interactions EXP 2326081 nicotinamide inhibits the reaction [5/6 nephrectomy increases the expression of Mlxipl protein in kidney] RGD Mlxipl Rat nicotinic acid decreases expression EXP 6480464 Niacin results in decreased expression of MLXIPL protein CTD PMID:19878707 Mlxipl Rat nordihydroguaiaretic acid decreases expression EXP 329955565 NDGA decreases expression of mRNA in liver of high fructose fed rats RGD Mlxipl Rat Nutlin-3 multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of MLXIPL mRNA CTD PMID:38460933 Mlxipl Rat oleic acid multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Mlxipl Rat paracetamol affects expression ISO Mlxipl (Mus musculus) 6480464 Acetaminophen affects the expression of MLXIPL mRNA CTD PMID:17562736 Mlxipl Rat paracetamol decreases expression ISO MLXIPL (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MLXIPL mRNA CTD PMID:26690555 Mlxipl Rat paracetamol decreases expression ISO Mlxipl (Mus musculus) 6480464 Acetaminophen results in decreased expression of MLXIPL mRNA CTD PMID:19420014 Mlxipl Rat paraquat decreases expression ISO MLXIPL (Homo sapiens) 6480464 Paraquat results in decreased expression of MLXIPL mRNA CTD PMID:34681664 Mlxipl Rat paxilline increases expression ISO MLXIPL (Homo sapiens) 6480464 paxilline results in increased expression of MLXIPL mRNA CTD PMID:32123961 Mlxipl Rat perfluorononanoic acid decreases expression ISO MLXIPL (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of MLXIPL mRNA CTD PMID:32588087 Mlxipl Rat perfluorooctane-1-sulfonic acid decreases expression ISO MLXIPL (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of MLXIPL mRNA CTD PMID:27153767 and PMID:32588087 Mlxipl Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mlxipl (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MLXIPL mRNA CTD PMID:36331819 Mlxipl Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of MLXIPL mRNA CTD PMID:31324951 Mlxipl Rat pirinixic acid multiple interactions ISO Mlxipl (Mus musculus) 6480464 pirinixic acid inhibits the reaction [Ethanol results in increased expression of MLXIPL mRNA] CTD PMID:18620774 Mlxipl Rat pirinixic acid multiple interactions EXP 6480464 MLXIPL protein inhibits the reaction [pirinixic acid results in decreased expression of PKLR mRNA] CTD PMID:16644726 Mlxipl Rat pirinixic acid decreases expression ISO Mlxipl (Mus musculus) 6480464 pirinixic acid results in decreased expression of MLXIPL mRNA CTD PMID:18445702 Mlxipl Rat propamocarb decreases expression ISO Mlxipl (Mus musculus) 6480464 propamocarb results in decreased expression of MLXIPL mRNA CTD PMID:29137890 Mlxipl Rat propiconazole multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [propiconazole co-treated with tebuconazole] results in increased expression of MLXIPL mRNA CTD PMID:30989312 Mlxipl Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MLXIPL mRNA CTD PMID:28374803 Mlxipl Rat salvianolic acid B multiple interactions EXP 6480464 salvianolic acid B inhibits the reaction [Ethanol results in increased expression of MLXIPL mRNA] more ... CTD PMID:27989594 Mlxipl Rat SB 431542 multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MLXIPL mRNA CTD PMID:27188386 Mlxipl Rat silicon dioxide decreases expression ISO MLXIPL (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MLXIPL mRNA CTD PMID:25895662 Mlxipl Rat sodium arsenate increases expression ISO Mlxipl (Mus musculus) 6480464 sodium arsenate results in increased expression of MLXIPL mRNA CTD PMID:30953684 Mlxipl Rat sodium arsenite increases expression ISO Mlxipl (Mus musculus) 6480464 sodium arsenite results in increased expression of MLXIPL mRNA CTD PMID:31532247 Mlxipl Rat sucrose multiple interactions ISO Mlxipl (Mus musculus) 6480464 [lard co-treated with Cholesterol co-treated with Sucrose] results in increased expression of MLXIPL mRNA and Atrazine promotes the reaction [[lard co-treated with Cholesterol co-treated with Sucrose] results in increased expression of MLXIPL mRNA] CTD PMID:24440342 Mlxipl Rat sulforaphane increases expression ISO MLXIPL (Homo sapiens) 6480464 sulforaphane results in increased expression of MLXIPL mRNA CTD PMID:31838189 Mlxipl Rat tamoxifen affects expression ISO Mlxipl (Mus musculus) 6480464 Tamoxifen affects the expression of MLXIPL mRNA CTD PMID:17555576 Mlxipl Rat taurine multiple interactions EXP 6480464 Taurine inhibits the reaction [Sodium Glutamate results in decreased expression of MLXIPL mRNA] CTD PMID:26092479 Mlxipl Rat tebuconazole multiple interactions ISO MLXIPL (Homo sapiens) 6480464 [propiconazole co-treated with tebuconazole] results in increased expression of MLXIPL mRNA and [tebuconazole co-treated with fludioxonil] results in decreased expression of MLXIPL mRNA CTD PMID:30989312 and PMID:33575850 Mlxipl Rat tebuconazole increases expression ISO MLXIPL (Homo sapiens) 6480464 tebuconazole results in increased expression of MLXIPL mRNA CTD PMID:30989312 Mlxipl Rat tetrachloromethane decreases expression ISO Mlxipl (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MLXIPL mRNA CTD PMID:27339419 and PMID:31919559 Mlxipl Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MLXIPL mRNA] CTD PMID:31150632 Mlxipl Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MLXIPL mRNA CTD PMID:31150632 Mlxipl Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of MLXIPL protein CTD PMID:35544339 Mlxipl Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MLXIPL mRNA CTD PMID:23411599 and PMID:34492290 Mlxipl Rat titanium dioxide decreases methylation ISO Mlxipl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MLXIPL gene CTD PMID:35295148 Mlxipl Rat triclosan decreases expression ISO MLXIPL (Homo sapiens) 6480464 Triclosan results in decreased expression of MLXIPL mRNA CTD PMID:34681664 Mlxipl Rat tris(2-butoxyethyl) phosphate affects expression ISO MLXIPL (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of MLXIPL mRNA CTD PMID:29024780 Mlxipl Rat trovafloxacin multiple interactions ISO Mlxipl (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in decreased expression of MLXIPL mRNA CTD PMID:18930950 Mlxipl Rat urethane decreases expression ISO MLXIPL (Homo sapiens) 6480464 Urethane results in decreased expression of MLXIPL mRNA CTD PMID:28818685 Mlxipl Rat valproic acid decreases expression ISO MLXIPL (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MLXIPL mRNA CTD PMID:29154799 Mlxipl Rat xylitol multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Aminooxyacetic Acid co-treated with Xylitol] results in increased expression of MLXIPL mRNA alternative form CTD PMID:31974165 Mlxipl Rat xylitol increases expression ISO Mlxipl (Mus musculus) 6480464 Xylitol results in increased expression of MLXIPL mRNA alternative form CTD PMID:31974165 Mlxipl Rat yohimbine multiple interactions ISO Mlxipl (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of MLXIPL mRNA CTD PMID:28843594
(+)-schisandrin B (EXP) (+/-)-Aegeline (ISO) (aminooxy)acetic acid (ISO) (RS)-coclaurine (ISO) (RS)-norcoclaurine (ISO) (S)-coclaurine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP,ISO) amiodarone (ISO) amitrole (EXP) arsenite(3-) (ISO) atorvastatin calcium (EXP) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bexarotene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) cetirizine (ISO) CGP 52608 (ISO) chlordecone (ISO) chloroethene (ISO) chlorpyrifos (ISO) cholesterol (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) copper(II) sulfate (ISO) CU-O LINKAGE (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (EXP,ISO) dexamethasone (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethyl phthalate (ISO) difenoconazole (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) disodium selenite (ISO) dorsomorphin (ISO) enilconazole (ISO) entinostat (ISO) ethanol (EXP,ISO) farnesol (ISO) fenthion (ISO) Fexofenadine hydrochloride (ISO) fludioxonil (ISO) folic acid (ISO) fructose (EXP,ISO) furan (EXP) glucose (EXP,ISO) glyphosate (ISO) GW 3965 (ISO) GW 4064 (ISO) GW 7647 (ISO) imidacloprid (ISO) indometacin (ISO) irinotecan (EXP) L-methionine (ISO) methimazole (EXP) monosodium L-glutamate (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP) nefazodone (EXP) nicotinamide (EXP) nicotinic acid (EXP) nordihydroguaiaretic acid (EXP) Nutlin-3 (ISO) oleic acid (ISO) paracetamol (ISO) paraquat (ISO) paxilline (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenformin (EXP) pirinixic acid (EXP,ISO) propamocarb (ISO) propiconazole (ISO) rotenone (EXP) salvianolic acid B (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sucrose (ISO) sulforaphane (ISO) tamoxifen (ISO) taurine (EXP) tebuconazole (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) triclosan (ISO) tris(2-butoxyethyl) phosphate (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) xylitol (ISO) yohimbine (ISO)
Biological Process
cellular response to glucose stimulus (IDA) energy homeostasis (IMP) fatty acid homeostasis (IMP) glucose homeostasis (IEA,ISO) glucose mediated signaling pathway (IEA,ISO) lipid biosynthetic process (IEA,ISO) negative regulation of DNA-templated transcription (IEA,ISO) negative regulation of oxidative phosphorylation (IEA,ISO) negative regulation of signal transduction by p53 class mediator (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of fatty acid biosynthetic process (IEA,ISO) positive regulation of glycolytic process (IEA,ISO) positive regulation of insulin secretion involved in cellular response to glucose stimulus (IEA,ISO) positive regulation of lipid biosynthetic process (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of transcription from RNA polymerase II promoter by glucose (IEA,ISO) regulation of glycolytic process (IDA) regulation of transcription by RNA polymerase II (IBA,IDA) response to glucose (IDA) response to nutrient (IEP) response to nutrient levels (IEP) response to vitamin B3 (IEP)
Cellular Component
chromatin (IEA,ISO) cytoplasm (IEA,ISO) cytosol (IDA,IEA,ISO,TAS) nucleoplasm (IEA,ISO,TAS) nucleus (IBA,IDA,IEA,ISO) transcription regulator complex (IEA,ISO)
Molecular Function
carbohydrate response element binding (NAS) DNA binding (IDA,IEA,ISO) DNA-binding transcription activator activity (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IDA) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO) DNA-binding transcription factor binding (IEA,ISO) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) protein binding (IPI,ISO) protein dimerization activity (IEA) protein heterodimerization activity (IEA,ISO) protein homodimerization activity (ISO) protein kinase binding (IPI) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) sequence-specific DNA binding (IDA)
1.
Fermented rice bran supplementation mitigates metabolic syndrome in stroke-prone spontaneously hypertensive rats.
Alauddin M, etal., BMC Complement Altern Med. 2016 Nov 8;16(1):442. doi: 10.1186/s12906-016-1427-z.
2.
Niacin improves renal lipid metabolism and slows progression in chronic kidney disease.
Cho KH, etal., Biochim Biophys Acta. 2010 Jan;1800(1):6-15. Epub 2009 Oct 28.
3.
WBSCR14, a putative transcription factor gene deleted in Williams-Beuren syndrome: complete characterisation of the human gene and the mouse ortholog.
de Luis O, etal., Eur J Hum Genet. 2000 Mar;8(3):215-22.
4.
Coordinate regulation/localization of the carbohydrate responsive binding protein (ChREBP) by two nuclear export signal sites: discovery of a new leucine-rich nuclear export signal site.
Fukasawa M, etal., Biochem Biophys Res Commun. 2010 Jan 8;391(2):1166-9. doi: 10.1016/j.bbrc.2009.11.115. Epub 2009 Dec 17.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
C771G (His241Gln) polymorphism of MLXIPL gene, TG levels and coronary artery disease: a case control study.
Ghasemi A, etal., Anatol J Cardiol. 2015 Jan;15(1):8-12. doi: 10.5152/akd.2014.5135. Epub 2014 Feb 10.
7.
ChREBP gene polymorphisms are associated with coronary artery disease in Han population of Hubei province.
Guo S, etal., Clin Chim Acta. 2011 Sep 18;412(19-20):1854-60. doi: 10.1016/j.cca.2011.06.024. Epub 2011 Jun 25.
8.
Fasting for 3 days during the suckling-weaning transient period in male rats induces metabolic abnormalities in the liver and is associated with impaired glucose tolerance in adulthood.
Ikeda M, etal., Eur J Nutr. 2016 Apr;55(3):1059-67. doi: 10.1007/s00394-015-0919-9. Epub 2015 May 6.
9.
Mechanism for fatty acid "sparing" effect on glucose-induced transcription: regulation of carbohydrate-responsive element-binding protein by AMP-activated protein kinase.
Kawaguchi T, etal., J Biol Chem 2002 Feb 8;277(6):3829-35.
10.
Therapeutic Effect of Gypenosides on Nonalcoholic Steatohepatitis via Regulating Hepatic Lipogenesis and Fatty Acid Oxidation.
Li H, etal., Biol Pharm Bull. 2017;40(5):650-657. doi: 10.1248/bpb.b16-00942.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Amino acid change in the carbohydrate response element binding protein is associated with lower triglycerides and myocardial infarction incidence depending on level of adherence to the Mediterranean diet in the PREDIMED trial.
Ortega-Azorín C, etal., Circ Cardiovasc Genet. 2014 Feb;7(1):49-58. doi: 10.1161/CIRCGENETICS.113.000301. Epub 2014 Jan 21.
13.
G771C Polymorphism in the MLXIPL Gene Is Associated with a Risk of Coronary Artery Disease in the Chinese: A Case-Control Study.
Pan LA, etal., Cardiology. 2009;114(3):174-8. doi: 10.1159/000226610. Epub 2009 Jul 2.
14.
A common variant association study in ethnic Saudi Arabs reveals novel susceptibility loci for hypertriglyceridemia.
Ram R, etal., Clin Genet. 2017 Mar;91(3):371-378. doi: 10.1111/cge.12859. Epub 2017 Jan 30.
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Beneficial effects of cherry consumption as a dietary intervention for metabolic, hepatic and vascular complications in type 2 diabetic rats.
Van der Werf R, etal., Cardiovasc Diabetol. 2018 Jul 20;17(1):104. doi: 10.1186/s12933-018-0744-6.
18.
The effect of extended lymphadenectomy on survival in patients with gastric adenocarcinoma.
Volpe CM, etal., J Am Coll Surg. 1995 Jul;181(1):56-64.
19.
Serelaxin improves cardiac and renal function in DOCA-salt hypertensive rats.
Wang D, etal., Sci Rep. 2017 Aug 29;7(1):9793. doi: 10.1038/s41598-017-09470-0.
20.
Study of the association of 17 lipid-related gene polymorphisms with coronary heart disease.
Wu N, etal., Anatol J Cardiol. 2018 Jun;19(6):360-367. doi: 10.14744/AnatolJCardiol.2018.23682.
21.
A glucose-responsive transcription factor that regulates carbohydrate metabolism in the liver.
Yamashita H, etal., Proc Natl Acad Sci U S A. 2001 Jul 31;98(16):9116-21. Epub 2001 Jul 24.
22.
Effect of Creosote Bush-Derived NDGA on Expression of Genes Involved in Lipid Metabolism in Liver of High-Fructose Fed Rats: Relevance to NDGA Amelioration of Hypertriglyceridemia and Hepatic Steatosis.
Zhang H, etal., PLoS One. 2015 Sep 22;10(9):e0138203. doi: 10.1371/journal.pone.0138203. eCollection 2015.
Mlxipl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 27,178,158 - 27,213,675 (-) NCBI GRCr8 mRatBN7.2 12 21,541,608 - 21,577,120 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 21,543,576 - 21,577,112 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 22,683,529 - 22,719,209 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 23,295,853 - 23,331,535 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 22,362,318 - 22,398,011 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 24,590,645 - 24,619,639 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 12 26,588,220 - 26,620,779 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 12 23,305,691 - 23,340,439 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
MLXIPL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 73,593,202 - 73,647,907 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 73,593,194 - 73,624,543 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 73,007,532 - 73,038,852 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 72,645,460 - 72,676,806 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 72,452,174 - 72,483,521 NCBI Celera 7 68,485,730 - 68,517,088 (-) NCBI Celera Cytogenetic Map 7 q11.23 NCBI HuRef 7 68,888,586 - 68,920,882 (-) NCBI HuRef CHM1_1 7 73,153,232 - 73,184,532 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 74,794,073 - 74,848,925 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 72,340,596 - 72,371,942 (-) NCBI
Mlxipl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 135,118,744 - 135,168,622 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 135,118,744 - 135,167,236 (+) Ensembl GRCm39 Ensembl GRCm38 5 135,089,890 - 135,139,768 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 135,089,890 - 135,138,382 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 135,582,783 - 135,613,792 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 135,391,540 - 135,426,429 (+) NCBI MGSCv36 mm8 Celera 5 132,118,107 - 132,149,116 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 75.0 NCBI
Mlxipl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 14,096,531 - 14,117,269 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 14,096,530 - 14,116,687 (+) NCBI ChiLan1.0 ChiLan1.0
MLXIPL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 91,254,158 - 91,308,364 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 139,541,661 - 139,572,996 (+) NCBI NHGRI_mPanPan1 PanPan1.1 7 80,745,765 - 80,776,156 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 80,745,765 - 80,776,153 (-) Ensembl panpan1.1 panPan2
MLXIPL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 6,617,398 - 6,652,201 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 6,633,231 - 6,652,198 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 8,314,804 - 8,349,596 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 6,448,811 - 6,467,272 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 6,448,825 - 6,467,255 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 6,421,940 - 6,456,726 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 6,369,681 - 6,404,478 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 6,533,405 - 6,568,214 (+) NCBI UU_Cfam_GSD_1.0
Mlxipl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 131,163,797 - 131,197,462 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936543 2,839,105 - 2,857,002 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936543 2,839,105 - 2,856,997 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MLXIPL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 10,898,670 - 10,934,048 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 10,898,675 - 10,934,257 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 10,598,366 - 10,632,610 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MLXIPL
Mlxipl
.
Predicted Target Of
Count of predictions: 91 Count of miRNA genes: 75 Interacting mature miRNAs: 85 Transcripts: ENSRNOT00000074230 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 19610870 24139202 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 631521 Pia12 Pristane induced arthritis QTL 12 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 20259417 23672083 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
BI277291
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 21,543,682 - 21,543,897 (+) MAPPER mRatBN7.2 Rnor_6.0 12 24,590,762 - 24,590,976 NCBI Rnor6.0 Rnor_5.0 12 26,588,337 - 26,588,551 UniSTS Rnor5.0 Celera 12 23,305,808 - 23,306,022 UniSTS RH 3.4 Map 12 341.51 UniSTS
Wbscr14
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 21,544,143 - 21,545,203 (+) MAPPER mRatBN7.2 Rnor_6.0 12 24,591,223 - 24,592,282 NCBI Rnor6.0 Rnor_5.0 12 26,588,798 - 26,589,857 UniSTS Rnor5.0 Celera 12 23,306,269 - 23,307,328 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
6
31
34
30
18
6
18
6
58
24
19
10
19
12
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071067 ⟹ ENSRNOP00000093059
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 21,543,576 - 21,577,112 (-) Ensembl Rnor_6.0 Ensembl 12 24,591,199 - 24,619,607 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000074230 ⟹ ENSRNOP00000090385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 21,543,576 - 21,577,112 (-) Ensembl Rnor_6.0 Ensembl 12 24,590,645 - 24,600,065 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 24,606,260 - 24,619,639 (-) Ensembl
RefSeq Acc Id:
NM_001393706 ⟹ NP_001380635
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,178,158 - 27,213,660 (-) NCBI mRatBN7.2 12 21,541,608 - 21,577,116 (-) NCBI
RefSeq Acc Id:
NM_133552 ⟹ NP_598236
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,178,158 - 27,213,656 (-) NCBI mRatBN7.2 12 21,541,608 - 21,577,112 (-) NCBI Rnor_6.0 12 24,590,645 - 24,619,639 (-) NCBI Rnor_5.0 12 26,588,220 - 26,620,779 (-) NCBI Celera 12 23,305,691 - 23,340,439 (-) RGD
Sequence:
GAGAGTGTCCGGGAGTTGGCGACAATAGTGGCCATGGCGCGCGCGCTGGCGGATCTATCCGTGAACTTGCAGGTCCCCCGGGTCGTCCCCAGCCCGGATTCGGACTCGGATACAGACTTGGAGGATCC
hide sequence
RefSeq Acc Id:
XM_039089043 ⟹ XP_038944971
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,178,158 - 27,206,487 (-) NCBI mRatBN7.2 12 21,542,964 - 21,569,900 (-) NCBI
RefSeq Acc Id:
XM_039089044 ⟹ XP_038944972
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,178,158 - 27,191,643 (-) NCBI mRatBN7.2 12 21,542,964 - 21,555,070 (-) NCBI
RefSeq Acc Id:
XM_063271027 ⟹ XP_063127097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,178,158 - 27,191,643 (-) NCBI
RefSeq Acc Id:
XM_063271028 ⟹ XP_063127098
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,183,925 - 27,213,675 (-) NCBI
RefSeq Acc Id:
XR_005491593
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,183,826 - 27,213,675 (-) NCBI mRatBN7.2 12 21,547,276 - 21,577,120 (-) NCBI
RefSeq Acc Id:
XR_005491594
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 27,183,823 - 27,213,675 (-) NCBI mRatBN7.2 12 21,547,273 - 21,577,120 (-) NCBI
RefSeq Acc Id:
NP_598236 ⟸ NM_133552
- Peptide Label:
isoform 2
- UniProtKB:
Q8VIP2 (UniProtKB/Swiss-Prot), A6J0E8 (UniProtKB/TrEMBL)
- Sequence:
MARALADLSVNLQVPRVVPSPDSDSDTDLEDPSPRRSAGGLHRSQVIHSGHFMVSSPHSDSLTRRRDQEGPVGLADFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWR
hide sequence
RefSeq Acc Id:
XP_038944971 ⟸ XM_039089043
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038944972 ⟸ XM_039089044
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000090385 ⟸ ENSRNOT00000074230
Ensembl Acc Id:
ENSRNOP00000093059 ⟸ ENSRNOT00000071067
RefSeq Acc Id:
NP_001380635 ⟸ NM_001393706
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6ADP9 (UniProtKB/TrEMBL), C7C5T1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127097 ⟸ XM_063271027
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063127098 ⟸ XM_063271028
- Peptide Label:
isoform X4
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-08-15
Mlxipl
MLX interacting protein-like
Wbscr14
Williams-Beuren syndrome chromosome region 14 homolog (human)
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2005-07-08
Wbscr14
Williams-Beuren syndrome chromosome region 14 homolog (human)
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Wbscr14
Williams-Beuren syndrome chromosome region 14 homolog (human)
Symbol and Name status set to provisional
70820 PROVISIONAL
