Symbol:
Ube2g1
Name:
ubiquitin-conjugating enzyme E2G 1
RGD ID:
620392
Description:
Enables ubiquitin-protein transferase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process; protein K48-linked ubiquitination; and protein K63-linked ubiquitination. Orthologous to human UBE2G1 (ubiquitin conjugating enzyme E2 G1); PARTICIPATES IN altered ubiquitin/proteasome degradation pathway; Alzheimer's disease pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E2 ubiquitin-conjugating enzyme G1; E217K; MGC93103; Ubc7; ubiquitin carrier protein G1; ubiquitin-conjugating enzyme E2 G1; ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans); ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast); ubiquitin-conjugating enzyme UBC7; ubiquitin-protein ligase G1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UBE2G1 (ubiquitin conjugating enzyme E2 G1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ube2g1 (ubiquitin-conjugating enzyme E2G 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ube2g1 (ubiquitin conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
UBE2G1 (ubiquitin conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UBE2G1 (ubiquitin conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101977945 (ubiquitin-conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
UBE2G1 (ubiquitin conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
UBE2G1 (ubiquitin conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ube2g1 (ubiquitin conjugating enzyme E2 G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ube2g1 (ubiquitin-conjugating enzyme E2G 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
UBE2G1 (ubiquitin conjugating enzyme E2 G1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ube2g1a (ubiquitin-conjugating enzyme E2G 1a (UBC7 homolog, yeast))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CDC34
Alliance
DIOPT (InParanoid|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG40045
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ubc87F
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ubc-7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ube2g1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 57,723,660 - 57,805,284 (+) NCBI GRCr8 mRatBN7.2 10 57,225,963 - 57,306,748 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 57,225,952 - 57,308,568 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 61,889,434 - 61,967,059 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 61,377,917 - 61,455,534 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 56,876,983 - 56,954,613 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 59,173,268 - 59,254,458 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 59,173,268 - 59,254,453 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 58,911,569 - 58,992,368 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 59,495,501 - 59,576,926 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 59,509,123 - 59,590,547 (+) NCBI Celera 10 56,350,633 - 56,430,320 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ube2g1 Rat 1,2-dichloroethane decreases expression ISO Ube2g1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of UBE2G1 mRNA CTD PMID:28960355 Ube2g1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ube2g1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UBE2G1 mRNA CTD PMID:22206623 Ube2g1 Rat 1,2-dimethylhydrazine decreases expression ISO Ube2g1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of UBE2G1 mRNA CTD PMID:22206623 Ube2g1 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of UBE2G1 mRNA CTD PMID:24140754 Ube2g1 Rat 17beta-estradiol decreases expression ISO Ube2g1 (Mus musculus) 6480464 Estradiol results in decreased expression of UBE2G1 mRNA CTD PMID:39298647 Ube2g1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO UBE2G1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of UBE2G1 mRNA CTD PMID:29581250 Ube2g1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of UBE2G1 mRNA CTD PMID:21215274 and PMID:33387578 Ube2g1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ube2g1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UBE2G1 mRNA CTD PMID:21570461 Ube2g1 Rat 2-methylcholine affects expression ISO UBE2G1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of UBE2G1 mRNA CTD PMID:21179406 Ube2g1 Rat 7,12-dimethyltetraphene affects expression ISO Ube2g1 (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Ube2g1 Rat all-trans-retinoic acid decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of UBE2G1 mRNA CTD PMID:33167477 Ube2g1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UBE2G1 mRNA CTD PMID:16483693 Ube2g1 Rat atrazine decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Atrazine results in decreased expression of UBE2G1 mRNA CTD PMID:22378314 Ube2g1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of UBE2G1 gene CTD PMID:35440735 Ube2g1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO UBE2G1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Ube2g1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ube2g1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of UBE2G1 mRNA CTD PMID:33754040 Ube2g1 Rat bisphenol A decreases expression ISO Ube2g1 (Mus musculus) 6480464 bisphenol A results in decreased expression of UBE2G1 mRNA CTD PMID:26063408 and PMID:33221593 Ube2g1 Rat bisphenol A decreases expression ISO UBE2G1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of UBE2G1 mRNA CTD PMID:29275510 Ube2g1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of UBE2G1 gene CTD PMID:28505145 Ube2g1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UBE2G1 mRNA CTD PMID:25181051 Ube2g1 Rat calcitriol multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of UBE2G1 mRNA CTD PMID:15913539 Ube2g1 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of UBE2G1 mRNA CTD PMID:15913539 Ube2g1 Rat calcium atom multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of UBE2G1 mRNA CTD PMID:15913539 Ube2g1 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of UBE2G1 mRNA CTD PMID:15913539 Ube2g1 Rat calcium(0) multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of UBE2G1 mRNA CTD PMID:15913539 Ube2g1 Rat choline multiple interactions ISO Ube2g1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of UBE2G1 gene CTD PMID:20938992 Ube2g1 Rat ciguatoxin CTX1B affects expression ISO Ube2g1 (Mus musculus) 6480464 Ciguatoxins affects the expression of UBE2G1 mRNA CTD PMID:18353800 Ube2g1 Rat cisplatin decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of UBE2G1 mRNA CTD PMID:27594783 Ube2g1 Rat cobalt dichloride increases expression ISO UBE2G1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of UBE2G1 mRNA CTD PMID:19376846 Ube2g1 Rat doxorubicin decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of UBE2G1 mRNA CTD PMID:29803840 Ube2g1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of UBE2G1 mRNA CTD PMID:31464424 Ube2g1 Rat ethanol affects splicing ISO Ube2g1 (Mus musculus) 6480464 Ethanol affects the splicing of UBE2G1 mRNA CTD PMID:30319688 Ube2g1 Rat ethyl methanesulfonate decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of UBE2G1 mRNA CTD PMID:23649840 Ube2g1 Rat fenthion increases expression ISO Ube2g1 (Mus musculus) 6480464 Fenthion results in increased expression of UBE2G1 mRNA CTD PMID:34813904 Ube2g1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of UBE2G1 mRNA CTD PMID:24793618 Ube2g1 Rat folic acid multiple interactions ISO Ube2g1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ube2g1 Rat folic acid decreases expression ISO Ube2g1 (Mus musculus) 6480464 Folic Acid results in decreased expression of UBE2G1 mRNA CTD PMID:25629700 Ube2g1 Rat formaldehyde decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of UBE2G1 mRNA CTD PMID:23649840 Ube2g1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of UBE2G1 mRNA CTD PMID:22061828 Ube2g1 Rat ivermectin decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of UBE2G1 protein CTD PMID:32959892 Ube2g1 Rat L-methionine multiple interactions ISO Ube2g1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of UBE2G1 gene CTD PMID:20938992 Ube2g1 Rat methidathion increases expression ISO Ube2g1 (Mus musculus) 6480464 methidathion results in increased expression of UBE2G1 mRNA CTD PMID:34813904 Ube2g1 Rat methyl methanesulfonate decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of UBE2G1 mRNA CTD PMID:23649840 Ube2g1 Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of UBE2G1 mRNA CTD PMID:18801959 Ube2g1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of UBE2G1 mRNA CTD PMID:25729387 Ube2g1 Rat paracetamol increases expression ISO UBE2G1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of UBE2G1 mRNA CTD PMID:21420995 Ube2g1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of UBE2G1 mRNA CTD PMID:33387578 Ube2g1 Rat potassium dichromate increases expression ISO UBE2G1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of UBE2G1 protein CTD PMID:23718831 Ube2g1 Rat rotenone decreases expression ISO Ube2g1 (Mus musculus) 6480464 Rotenone results in decreased expression of UBE2G1 mRNA CTD PMID:23186747 Ube2g1 Rat rotenone increases expression ISO UBE2G1 (Homo sapiens) 6480464 Rotenone results in increased expression of UBE2G1 mRNA CTD PMID:33512557 Ube2g1 Rat sarin decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Sarin results in decreased expression of UBE2G1 mRNA CTD PMID:19522546 Ube2g1 Rat sertraline decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Sertraline results in decreased expression of UBE2G1 mRNA CTD PMID:24865413 Ube2g1 Rat sodium arsenate increases expression ISO Ube2g1 (Mus musculus) 6480464 sodium arsenate results in increased expression of UBE2G1 mRNA CTD PMID:21795629 Ube2g1 Rat sodium arsenite increases expression ISO UBE2G1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of UBE2G1 mRNA CTD PMID:20886546 Ube2g1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of UBE2G1 mRNA CTD PMID:30690589 Ube2g1 Rat tetrachloromethane increases methylation EXP 6480464 Carbon Tetrachloride results in increased methylation of UBE2G1 promoter CTD PMID:30690589 Ube2g1 Rat tetraphene increases expression ISO Ube2g1 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of UBE2G1 mRNA CTD PMID:26377693 Ube2g1 Rat thiram decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Thiram results in decreased expression of UBE2G1 mRNA CTD PMID:38568856 Ube2g1 Rat titanium dioxide decreases expression ISO Ube2g1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of UBE2G1 mRNA CTD PMID:29264374 Ube2g1 Rat titanium dioxide increases methylation ISO Ube2g1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of UBE2G1 promoter CTD PMID:35295148 Ube2g1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of UBE2G1 mRNA CTD PMID:25729387 Ube2g1 Rat valproic acid affects expression ISO UBE2G1 (Homo sapiens) 6480464 Valproic Acid affects the expression of UBE2G1 mRNA CTD PMID:25979313 Ube2g1 Rat vincristine decreases expression ISO UBE2G1 (Homo sapiens) 6480464 Vincristine results in decreased expression of UBE2G1 mRNA CTD PMID:23649840
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 7,12-dimethyltetraphene (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) atrazine (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) calcitriol (EXP) calcium atom (EXP) calcium(0) (EXP) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt dichloride (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) ethyl methanesulfonate (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) ivermectin (ISO) L-methionine (ISO) methidathion (ISO) methyl methanesulfonate (ISO) monocrotaline (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) potassium dichromate (ISO) rotenone (ISO) sarin (ISO) sertraline (ISO) sodium arsenate (ISO) sodium arsenite (ISO) tetrachloromethane (EXP) tetraphene (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) valproic acid (ISO) vincristine (ISO)
Ube2g1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 57,723,660 - 57,805,284 (+) NCBI GRCr8 mRatBN7.2 10 57,225,963 - 57,306,748 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 57,225,952 - 57,308,568 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 61,889,434 - 61,967,059 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 61,377,917 - 61,455,534 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 56,876,983 - 56,954,613 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 59,173,268 - 59,254,458 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 59,173,268 - 59,254,453 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 58,911,569 - 58,992,368 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 59,495,501 - 59,576,926 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 59,509,123 - 59,590,547 (+) NCBI Celera 10 56,350,633 - 56,430,320 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
UBE2G1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 4,269,259 - 4,366,675 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 4,269,259 - 4,366,675 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 4,172,554 - 4,269,970 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 4,119,261 - 4,216,718 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 4,120,876 - 4,216,722 NCBI Celera 17 4,183,990 - 4,282,343 (-) NCBI Celera Cytogenetic Map 17 p13.2 NCBI HuRef 17 4,061,449 - 4,158,493 (-) NCBI HuRef CHM1_1 17 4,181,272 - 4,278,736 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 4,158,500 - 4,255,938 (-) NCBI T2T-CHM13v2.0
Ube2g1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 72,498,087 - 72,577,307 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 72,498,109 - 72,577,307 (+) Ensembl GRCm39 Ensembl GRCm38 11 72,607,261 - 72,686,481 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 72,607,283 - 72,686,481 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 72,420,763 - 72,499,983 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 72,423,784 - 72,500,807 (+) NCBI MGSCv36 mm8 Celera 11 80,131,240 - 80,211,961 (+) NCBI Celera Cytogenetic Map 11 B4 NCBI cM Map 11 44.42 NCBI
Ube2g1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 12,551,826 - 12,640,786 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 12,552,001 - 12,639,620 (+) NCBI ChiLan1.0 ChiLan1.0
UBE2G1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 11,885,096 - 11,978,511 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 13,848,503 - 13,945,846 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 4,321,294 - 4,416,936 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 4,312,625 - 4,402,977 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 4,312,625 - 4,351,697 (-) Ensembl panpan1.1 panPan2
UBE2G1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 30,332,277 - 30,430,225 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 30,334,968 - 30,427,529 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 30,527,970 - 30,628,947 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 30,432,365 - 30,533,455 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 30,435,056 - 30,533,348 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 30,398,854 - 30,500,025 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 30,357,216 - 30,458,176 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 30,530,615 - 30,631,609 (-) NCBI UU_Cfam_GSD_1.0
LOC101977945
UBE2G1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 50,266,696 - 50,348,689 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 50,258,037 - 50,368,621 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 52,194,818 - 52,279,948 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UBE2G1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 3,743,036 - 3,845,567 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 3,742,881 - 3,845,522 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 17,832,258 - 17,932,674 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ube2g1
.
Predicted Target Of
Count of predictions: 135 Count of miRNA genes: 88 Interacting mature miRNAs: 119 Transcripts: ENSRNOT00000013486 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 2298495 Eae23 Experimental allergic encephalomyelitis QTL 23 16.93 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 10 55273696 60677262 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH71332
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 66,606,809 - 66,606,999 (+) MAPPER mRatBN7.2 Rnor_6.0 13 71,931,591 - 71,931,780 NCBI Rnor6.0 Rnor_5.0 13 76,875,016 - 76,875,205 UniSTS Rnor5.0 RGSC_v3.4 13 69,391,752 - 69,391,941 UniSTS RGSC3.4 RGSC_v3.4 7 5,332,129 - 5,332,317 UniSTS RGSC3.4 Celera 13 66,488,428 - 66,488,617 UniSTS Celera 7 3,069,950 - 3,070,138 UniSTS Cytogenetic Map 10 q24 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 13 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013486 ⟹ ENSRNOP00000013486
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 57,225,952 - 57,308,568 (+) Ensembl Rnor_6.0 Ensembl 10 59,173,268 - 59,254,453 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102884 ⟹ ENSRNOP00000088049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 57,281,551 - 57,308,568 (+) Ensembl
RefSeq Acc Id:
NM_022690 ⟹ NP_073181
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 57,724,508 - 57,805,284 (+) NCBI mRatBN7.2 10 57,225,963 - 57,306,748 (+) NCBI Rnor_6.0 10 59,173,268 - 59,254,458 (+) NCBI Rnor_5.0 10 58,911,569 - 58,992,368 (+) NCBI RGSC_v3.4 10 59,495,501 - 59,576,926 (+) RGD Celera 10 56,350,633 - 56,430,320 (+) RGD
Sequence:
GGAAGGCACCGGTGGGGCCGACGGGCGGGCTGAGGAGGGAAGCGGGCGAGCGAAGTCCCAGTGCGCGCCGCGGCGGCCCGGGTACCCTCCCCTTCCGGGCGTGAGCCGCTGAGAGGAAAGCCGAGCGG
hide sequence
RefSeq Acc Id:
XM_063269819 ⟹ XP_063125889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 57,723,660 - 57,805,284 (+) NCBI
RefSeq Acc Id:
NP_073181 ⟸ NM_022690
- UniProtKB:
P62255 (UniProtKB/Swiss-Prot), A6HGG3 (UniProtKB/TrEMBL), A0A8I6AHY2 (UniProtKB/TrEMBL)
- Sequence:
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISML
hide sequence
Ensembl Acc Id:
ENSRNOP00000013486 ⟸ ENSRNOT00000013486
Ensembl Acc Id:
ENSRNOP00000088049 ⟸ ENSRNOT00000102884
RefSeq Acc Id:
XP_063125889 ⟸ XM_063269819
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AHY2 (UniProtKB/TrEMBL)
RGD ID: 13697393 Promoter ID: EPDNEW_R7917 Type: initiation region Name: Ube2g1_1 Description: ubiquitin-conjugating enzyme E2G 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 59,173,247 - 59,173,307 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-01
Ube2g1
ubiquitin-conjugating enzyme E2G 1
Ube2g1
ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-25
Ube2g1
ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
Ube2g1
ubiquitin-conjugating enzyme E2G 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-02-25
Ube2g1
ubiquitin-conjugating enzyme E2G 1
Ube2g1
ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Ube2g1
ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)
Ubc7
ubiquitin-conjugating enzyme UBC7
Symbol and Name updated
1299863 APPROVED
2002-08-07
Ubc7
ubiquitin-conjugating enzyme UBC7
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in all tissues with the highest levels seen in the testis
634475
