Symbol:
Phyh
Name:
phytanoyl-CoA 2-hydroxylase
RGD ID:
620317
Description:
Enables phytanoyl-CoA dioxygenase activity. Involved in 2-oxobutyrate catabolic process and fatty acid alpha-oxidation. Located in peroxisome. Biomarker of metabolic dysfunction-associated steatotic liver disease. Human ortholog(s) of this gene implicated in Refsum disease; Zellweger syndrome; orofacial cleft; and peroxisomal disease. Orthologous to human PHYH (phytanoyl-CoA 2-hydroxylase); PARTICIPATES IN phytanic acid degradation pathway; Refsum disease pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,4,7,8-Pentachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
phytanic acid oxidase; phytanoyl-CoA alpha-hydroxylase; phytanoyl-CoA dioxygenase, peroxisomal; phytanoyl-CoA hydroxylase; phytanoyl-CoA hydroxylase (Refsum disease)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 78,238,747 - 78,255,645 (-) NCBI GRCr8 mRatBN7.2 17 73,329,461 - 73,346,359 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 73,329,082 - 73,346,409 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 76,834,020 - 76,851,123 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 80,658,833 - 80,675,645 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 74,709,804 - 74,727,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 77,287,580 - 77,304,482 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 77,287,188 - 77,304,530 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 78,953,400 - 78,970,299 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 84,418,173 - 84,435,073 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 84,429,005 - 84,445,906 (-) NCBI Celera 17 72,770,062 - 72,786,946 (-) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Phyh Rat 1,2-dimethylhydrazine multiple interactions ISO Phyh (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PHYH mRNA CTD PMID:22206623 Phyh Rat 1,2-dimethylhydrazine decreases expression ISO Phyh (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PHYH mRNA CTD PMID:22206623 Phyh Rat 17alpha-ethynylestradiol multiple interactions ISO Phyh (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PHYH mRNA CTD PMID:17942748 Phyh Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PHYH mRNA CTD PMID:15953391 more ... Phyh Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of PHYH mRNA CTD PMID:26496021 Phyh Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PHYH protein CTD PMID:32145629 Phyh Rat 2,3,4,7,8-Pentachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Phyh Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Phyh (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PHYH mRNA CTD PMID:17942748 Phyh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PHYH mRNA CTD PMID:34747641 Phyh Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Phyh (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Phyh Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in decreased expression of PHYH mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in decreased expression of PHYH mRNA CTD PMID:14656948 and PMID:16158176 Phyh Rat 2-methylcholine affects expression ISO PHYH (Homo sapiens) 6480464 beta-methylcholine affects the expression of PHYH mRNA CTD PMID:21179406 Phyh Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Phyh Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Phyh (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Phyh Rat 4,4'-sulfonyldiphenol increases expression ISO Phyh (Mus musculus) 6480464 bisphenol S results in increased expression of PHYH mRNA CTD PMID:39298647 Phyh Rat 5-aza-2'-deoxycytidine affects expression ISO PHYH (Homo sapiens) 6480464 Decitabine affects the expression of PHYH mRNA CTD PMID:23300844 Phyh Rat 5-fluorouracil affects response to substance ISO PHYH (Homo sapiens) 6480464 PHYH protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Phyh Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat acetamide affects expression EXP 6480464 acetamide affects the expression of PHYH mRNA CTD PMID:31881176 Phyh Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PHYH mRNA CTD PMID:28959563 Phyh Rat aflatoxin B1 decreases expression ISO PHYH (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PHYH mRNA CTD PMID:27153756 Phyh Rat all-trans-retinoic acid decreases expression ISO PHYH (Homo sapiens) 6480464 Tretinoin results in decreased expression of PHYH mRNA CTD PMID:33167477 Phyh Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat amitriptyline increases expression ISO PHYH (Homo sapiens) 6480464 Amitriptyline results in increased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PHYH mRNA CTD PMID:16483693 Phyh Rat antirheumatic drug increases expression ISO PHYH (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PHYH mRNA CTD PMID:24449571 Phyh Rat aristolochic acid A increases expression ISO PHYH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PHYH mRNA CTD PMID:33212167 Phyh Rat Aroclor 1254 decreases expression ISO Phyh (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PHYH mRNA CTD PMID:23650126 Phyh Rat arsane affects methylation ISO PHYH (Homo sapiens) 6480464 Arsenic affects the methylation of PHYH gene CTD PMID:25304211 Phyh Rat arsenic atom affects methylation ISO PHYH (Homo sapiens) 6480464 Arsenic affects the methylation of PHYH gene CTD PMID:25304211 Phyh Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat bis(2-chloroethyl) sulfide increases expression ISO Phyh (Mus musculus) 6480464 Mustard Gas results in increased expression of PHYH mRNA CTD PMID:15674844 Phyh Rat bis(2-ethylhexyl) phthalate decreases expression ISO Phyh (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PHYH mRNA CTD PMID:34319233 Phyh Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of PHYH mRNA CTD PMID:26496021 Phyh Rat bisphenol A increases expression ISO PHYH (Homo sapiens) 6480464 bisphenol A results in increased expression of PHYH mRNA CTD PMID:29275510 Phyh Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PHYH mRNA CTD PMID:30903817 Phyh Rat bisphenol A affects expression ISO PHYH (Homo sapiens) 6480464 bisphenol A affects the expression of PHYH mRNA CTD PMID:30903817 Phyh Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PHYH mRNA and bisphenol A results in decreased expression of PHYH protein CTD PMID:30816183 and PMID:32145629 Phyh Rat bisphenol AF increases expression ISO PHYH (Homo sapiens) 6480464 bisphenol AF results in increased expression of PHYH protein CTD PMID:34186270 Phyh Rat chlorpromazine increases expression ISO PHYH (Homo sapiens) 6480464 Chlorpromazine results in increased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat chlorpyrifos decreases expression ISO Phyh (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PHYH mRNA CTD PMID:37019170 Phyh Rat chromium(6+) affects expression ISO Phyh (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PHYH mRNA CTD PMID:28472532 Phyh Rat cisplatin affects expression ISO PHYH (Homo sapiens) 6480464 Cisplatin affects the expression of PHYH mRNA CTD PMID:23300844 Phyh Rat cisplatin increases expression ISO PHYH (Homo sapiens) 6480464 Cisplatin results in increased expression of PHYH mRNA CTD PMID:27392435 Phyh Rat cisplatin multiple interactions ISO PHYH (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PHYH mRNA CTD PMID:27392435 Phyh Rat clarithromycin decreases expression ISO PHYH (Homo sapiens) 6480464 Clarithromycin results in decreased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of PHYH mRNA CTD PMID:17602206 Phyh Rat clomipramine increases expression ISO PHYH (Homo sapiens) 6480464 Clomipramine results in increased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PHYH mRNA CTD PMID:24386269 Phyh Rat copper(II) sulfate decreases expression ISO PHYH (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PHYH mRNA CTD PMID:19549813 Phyh Rat crocidolite asbestos decreases expression ISO Phyh (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PHYH mRNA CTD PMID:29279043 Phyh Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of PHYH mRNA CTD PMID:18539377 Phyh Rat cyclosporin A decreases expression ISO PHYH (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PHYH mRNA CTD PMID:20106945 and PMID:25562108 Phyh Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PHYH mRNA CTD PMID:21266533 Phyh Rat dibutyl phthalate decreases expression ISO Phyh (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PHYH mRNA CTD PMID:21266533 Phyh Rat dicrotophos decreases expression ISO PHYH (Homo sapiens) 6480464 dicrotophos results in decreased expression of PHYH mRNA CTD PMID:28302478 Phyh Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PHYH mRNA CTD PMID:25152437 Phyh Rat dorsomorphin multiple interactions ISO PHYH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Phyh Rat doxorubicin affects expression ISO PHYH (Homo sapiens) 6480464 Doxorubicin affects the expression of PHYH mRNA CTD PMID:25529476 Phyh Rat doxorubicin decreases expression ISO PHYH (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PHYH mRNA CTD PMID:29803840 Phyh Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PHYH mRNA CTD PMID:29391264 Phyh Rat ethanol affects expression ISO Phyh (Mus musculus) 6480464 Ethanol affects the expression of PHYH mRNA CTD PMID:30319688 Phyh Rat ethyl methanesulfonate increases expression ISO PHYH (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of PHYH mRNA CTD PMID:23649840 Phyh Rat fenamidone increases expression ISO Phyh (Mus musculus) 6480464 fenamidone results in increased expression of PHYH mRNA CTD PMID:27029645 Phyh Rat folic acid multiple interactions ISO Phyh (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PHYH mRNA CTD PMID:22206623 Phyh Rat indometacin affects expression EXP 6480464 Indomethacin affects the expression of PHYH mRNA CTD PMID:36868495 Phyh Rat ivermectin decreases expression ISO PHYH (Homo sapiens) 6480464 Ivermectin results in decreased expression of PHYH protein CTD PMID:32959892 Phyh Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PHYH mRNA CTD PMID:30467583 Phyh Rat methotrexate increases expression ISO PHYH (Homo sapiens) 6480464 Methotrexate results in increased expression of PHYH mRNA CTD PMID:17400583 Phyh Rat methyl methanesulfonate increases expression ISO PHYH (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of PHYH mRNA CTD PMID:23649840 Phyh Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of PHYH mRNA CTD PMID:21515302 Phyh Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in decreased expression of PHYH mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in decreased expression of PHYH mRNA CTD PMID:14656948 and PMID:16158176 Phyh Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PHYH mRNA CTD PMID:22110744 Phyh Rat nitrates multiple interactions ISO Phyh (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PHYH mRNA CTD PMID:35964746 Phyh Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PHYH mRNA CTD PMID:33484710 Phyh Rat ofloxacin decreases expression ISO PHYH (Homo sapiens) 6480464 Ofloxacin results in decreased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PHYH mRNA CTD PMID:25729387 Phyh Rat ozone multiple interactions ISO Phyh (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PHYH mRNA CTD PMID:34911549 Phyh Rat paracetamol increases expression ISO PHYH (Homo sapiens) 6480464 Acetaminophen results in increased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat paracetamol affects expression ISO Phyh (Mus musculus) 6480464 Acetaminophen affects the expression of PHYH mRNA CTD PMID:17562736 Phyh Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of PHYH mRNA CTD PMID:32680482 Phyh Rat perfluorohexanesulfonic acid increases expression ISO Phyh (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of PHYH mRNA CTD PMID:37995155 Phyh Rat perfluorooctanoic acid decreases expression ISO Phyh (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of PHYH mRNA CTD PMID:17681415 Phyh Rat phenylmercury acetate multiple interactions ISO PHYH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PHYH mRNA CTD PMID:27188386 Phyh Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of PHYH mRNA CTD PMID:20726854 Phyh Rat Propiverine affects binding EXP 6480464 propiverine binds to PHYH protein CTD PMID:29273565 Phyh Rat resveratrol multiple interactions ISO Phyh (Mus musculus) 6480464 Resveratrol inhibits the reaction [titanium dioxide results in decreased expression of PHYH mRNA] CTD PMID:31298478 Phyh Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PHYH protein CTD PMID:35544339 Phyh Rat SB 431542 multiple interactions ISO PHYH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Phyh Rat sertraline increases expression ISO PHYH (Homo sapiens) 6480464 Sertraline results in increased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PHYH protein CTD PMID:29459688 Phyh Rat sodium arsenite increases expression ISO PHYH (Homo sapiens) 6480464 sodium arsenite results in increased expression of PHYH mRNA CTD PMID:38568856 Phyh Rat sotalol increases expression ISO PHYH (Homo sapiens) 6480464 Sotalol results in increased expression of PHYH mRNA CTD PMID:17567588 Phyh Rat sulfamethoxazole decreases expression ISO PHYH (Homo sapiens) 6480464 Sulfamethoxazole results in decreased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat sulforaphane increases expression ISO Phyh (Mus musculus) 6480464 sulforaphane results in increased expression of PHYH mRNA CTD PMID:30529165 Phyh Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of PHYH mRNA CTD PMID:15885361 Phyh Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of PHYH mRNA CTD PMID:21515302 Phyh Rat testosterone decreases expression ISO Phyh (Mus musculus) 6480464 Testosterone results in decreased expression of PHYH mRNA CTD PMID:19693291 Phyh Rat tetrachloromethane decreases expression ISO Phyh (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PHYH mRNA CTD PMID:31919559 Phyh Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PHYH mRNA CTD PMID:19483382 Phyh Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PHYH mRNA CTD PMID:34492290 Phyh Rat thioridazine increases expression ISO PHYH (Homo sapiens) 6480464 Thioridazine results in increased expression of PHYH mRNA CTD PMID:15342952 Phyh Rat titanium dioxide multiple interactions ISO Phyh (Mus musculus) 6480464 Resveratrol inhibits the reaction [titanium dioxide results in decreased expression of PHYH mRNA] CTD PMID:31298478 Phyh Rat titanium dioxide decreases expression ISO Phyh (Mus musculus) 6480464 titanium dioxide results in decreased expression of PHYH mRNA CTD PMID:31298478 Phyh Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PHYH mRNA CTD PMID:25729387 Phyh Rat trichostatin A decreases expression ISO PHYH (Homo sapiens) 6480464 trichostatin A results in decreased expression of PHYH mRNA CTD PMID:26272509 Phyh Rat trichostatin A multiple interactions ISO PHYH (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PHYH mRNA CTD PMID:27188386 Phyh Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of PHYH mRNA CTD PMID:21515302 Phyh Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of PHYH mRNA CTD PMID:24136188 Phyh Rat valproic acid decreases expression ISO PHYH (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PHYH mRNA CTD PMID:29154799 and PMID:29501571 Phyh Rat valproic acid decreases methylation ISO PHYH (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PHYH gene CTD PMID:29501571 Phyh Rat valproic acid affects expression ISO PHYH (Homo sapiens) 6480464 Valproic Acid affects the expression of PHYH mRNA CTD PMID:25979313 Phyh Rat valproic acid increases methylation ISO PHYH (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PHYH gene CTD PMID:29154799 Phyh Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PHYH mRNA CTD PMID:12672911 and PMID:15671213 Phyh Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PHYH mRNA CTD PMID:12672911 and PMID:15671213
Imported Annotations - SMPDB
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 2,3,4,7,8-Pentachlorodibenzofuran (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetamidofluorene (EXP) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) amitriptyline (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzbromarone (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) chlorpromazine (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) clarithromycin (ISO) clofibrate (EXP) clofibric acid (EXP) clomipramine (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) curcumin (EXP) cyclosporin A (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) ethyl methanesulfonate (ISO) fenamidone (ISO) folic acid (ISO) indometacin (EXP) ivermectin (ISO) L-ethionine (EXP) methapyrilene (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) Muraglitazar (EXP) N-nitrosodiethylamine (EXP) nickel dichloride (EXP) nitrates (ISO) nitrofen (EXP) ofloxacin (ISO) omeprazole (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) progesterone (EXP) Propiverine (EXP) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) sertraline (ISO) sodium arsenite (EXP,ISO) sotalol (ISO) sulfamethoxazole (ISO) sulforaphane (ISO) tauroursodeoxycholic acid (EXP) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thioridazine (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) troglitazone (EXP) valdecoxib (EXP) valproic acid (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Using Whole Exome Sequencing to Identify Candidate Genes With Rare Variants In Nonsyndromic Cleft Lip and Palate.
Aylward A, etal., Genet Epidemiol. 2016 Jul;40(5):432-41. doi: 10.1002/gepi.21972. Epub 2016 May 27.
2.
Ataxia with loss of Purkinje cells in a mouse model for Refsum disease.
Ferdinandusse S, etal., Proc Natl Acad Sci U S A. 2008 Nov 18;105(46):17712-7. doi: 10.1073/pnas.0806066105. Epub 2008 Nov 11.
3.
Further studies on the substrate spectrum of phytanoyl-CoA hydroxylase: implications for Refsum disease?
Foulon V, etal., J Lipid Res 2003 Dec;44(12):2349-55. Epub 2003 Aug 16.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Phytanoyl-CoA hydroxylase deficiency. Enzymological and molecular basis of classical Refsum disease.
Jansen GA, etal., Adv Exp Med Biol. 1999;466:371-6.
7.
Phytanoyl-CoA hydroxylase is present in human liver, located in peroxisomes, and deficient in Zellweger syndrome: direct, unequivocal evidence for the new, revised pathway of phytanic acid alpha-oxidation in humans.
Jansen GA, etal., Biochem Biophys Res Commun. 1996 Dec 4;229(1):205-10. doi: 10.1006/bbrc.1996.1781.
8.
Phytanoyl-CoA hydroxylase is not only deficient in classical Refsum disease but also in rhizomelic chondrodysplasia punctata.
Jansen GA, etal., J Inherit Metab Dis. 1997 Jul;20(3):444-6.
9.
Phytanoyl-CoA hydroxylase from rat liver. Protein purification and cDNA cloning with implications for the subcellular localization of phytanic acid alpha-oxidation.
Jansen GA, etal., J Lipid Res 1999 Dec;40(12):2244-54.
10.
Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
The subcellular localization of phytanic acid oxidase in rat liver.
Skjeldal OH and Stokke O, Biochim Biophys Acta. 1987 Sep 4;921(1):38-42.
19.
Isobaric tags for relative and absolute quantitation (iTRAQ)-based proteomics for the investigation of the effect of Hugan Qingzhi on non-alcoholic fatty liver disease in rats.
Yao X, etal., J Ethnopharmacol. 2018 Feb 15;212:208-215. doi: 10.1016/j.jep.2017.09.016. Epub 2017 Oct 13.
Phyh Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 78,238,747 - 78,255,645 (-) NCBI GRCr8 mRatBN7.2 17 73,329,461 - 73,346,359 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 73,329,082 - 73,346,409 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 76,834,020 - 76,851,123 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 80,658,833 - 80,675,645 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 74,709,804 - 74,727,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 77,287,580 - 77,304,482 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 77,287,188 - 77,304,530 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 78,953,400 - 78,970,299 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 84,418,173 - 84,435,073 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 84,429,005 - 84,445,906 (-) NCBI Celera 17 72,770,062 - 72,786,946 (-) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
PHYH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 13,277,799 - 13,300,064 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 13,277,796 - 13,302,412 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 13,319,799 - 13,342,064 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 13,359,802 - 13,382,136 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 13,359,805 - 13,382,107 NCBI Celera 10 13,246,935 - 13,269,237 (-) NCBI Celera Cytogenetic Map 10 p13 NCBI HuRef 10 13,232,668 - 13,254,996 (-) NCBI HuRef CHM1_1 10 13,319,709 - 13,342,691 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 13,290,862 - 13,313,116 (-) NCBI T2T-CHM13v2.0
Phyh Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 4,923,807 - 4,943,554 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 4,923,830 - 4,943,541 (+) Ensembl GRCm39 Ensembl GRCm38 2 4,918,996 - 4,938,743 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 4,919,019 - 4,938,730 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 4,840,042 - 4,859,789 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 4,836,303 - 4,855,996 (+) NCBI MGSCv36 mm8 Celera 2 4,874,084 - 4,893,837 (+) NCBI Celera Cytogenetic Map 2 A1 NCBI cM Map 2 3.06 NCBI
Phyh Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955462 1,238,622 - 1,250,736 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955462 1,238,622 - 1,250,731 (-) NCBI ChiLan1.0 ChiLan1.0
PHYH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 25,798,371 - 25,822,011 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 25,803,696 - 25,826,001 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 13,277,804 - 13,300,115 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 13,250,722 - 13,634,152 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 13,251,223 - 13,636,018 (-) Ensembl panpan1.1 panPan2
LOC478000 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 23,185,901 - 23,206,719 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 23,185,782 - 23,253,497 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 20,243,502 - 20,263,391 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 23,491,323 - 23,512,130 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 23,491,168 - 23,619,903 (+) Ensembl ROS_Cfam_1.0 Ensembl UNSW_CanFamBas_1.0 2 21,525,646 - 21,546,459 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 22,153,837 - 22,174,674 (+) NCBI UU_Cfam_GSD_1.0
PHYH
PHYH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 13,309,059 - 13,331,606 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 13,308,951 - 13,331,504 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 18,841,615 - 18,862,691 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Phyh
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 29 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000024362 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7411575 Bw140 Body weight QTL 140 30.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 2301412 Kidm40 Kidney mass QTL 40 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 37479847 82479847 Rat 631502 Cm26 Cardiac mass QTL 26 3.71 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 65703580 81153923 Rat 1354588 Bvd4 Brain ventricular dilatation QTL 4 5.31 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 53498828 82479847 Rat 7411577 Bw141 Body weight QTL 141 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 62619516 86533673 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2317038 Ginf3 Gastrointestinal inflammation QTL 3 2.89 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 17 49920154 86533673 Rat 724549 Niddm56 Non-insulin dependent diabetes mellitus QTL 56 0.03 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 31990784 76990784 Rat 1598871 Memor5 Memory QTL 5 5.3 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 17 40540041 80387013 Rat 2317045 Aia11 Adjuvant induced arthritis QTL 11 4.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 60781426 86533673 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 2317054 Aia12 Adjuvant induced arthritis QTL 12 4.24 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 38281509 83281509 Rat 8694181 Bw151 Body weight QTL 151 4.36 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 12904736 Cm121 Cardiac mass QTL 121 0.043 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 71774621 82479847 Rat 1300148 Bp192 Blood pressure QTL 192 3.47 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 17 34550843 73951021 Rat 2317060 Aia26 Adjuvant induced arthritis QTL 26 3.22 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 17 38281509 83281509 Rat 4889894 Eae33 Experimental allergic encephalomyelitis QTL 33 5.2 0.0001 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 50909099 86022412 Rat 2324621 Coatc5 Coat color QTL 5 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 17 31368391 73951021 Rat 1300131 Bp193 Blood pressure QTL 193 3.3 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 63640009 73951021 Rat 7488963 Bp369 Blood pressure QTL 369 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 59005649 77910000 Rat 1300129 Rf25 Renal function QTL 25 3.03 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 17 71003325 81153923 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1354663 Bvd5 Brain ventricular dilatation QTL 5 3.51 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 31990784 81292925 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 2302365 Gluco40 Glucose level QTL 40 4.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 57246843 82046127 Rat 2303580 Gluco49 Glucose level QTL 49 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 50040271 86533673 Rat
RH129871
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 73,329,149 - 73,329,343 (+) MAPPER mRatBN7.2 Rnor_6.0 17 77,287,269 - 77,287,462 NCBI Rnor6.0 Rnor_5.0 17 78,953,089 - 78,953,282 UniSTS Rnor5.0 RGSC_v3.4 17 84,417,862 - 84,418,055 UniSTS RGSC3.4 Celera 17 72,769,751 - 72,769,944 UniSTS RH 3.4 Map 17 725.7 UniSTS Cytogenetic Map 17 q12.3 UniSTS
AI256161
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 78,238,595 - 78,238,675 (+) Marker Load Pipeline mRatBN7.2 17 73,329,308 - 73,329,389 (+) MAPPER mRatBN7.2 Rnor_6.0 17 77,287,428 - 77,287,508 NCBI Rnor6.0 Rnor_5.0 17 78,953,248 - 78,953,328 UniSTS Rnor5.0 RGSC_v3.4 17 84,418,021 - 84,418,101 UniSTS RGSC3.4 Celera 17 72,769,910 - 72,769,990 UniSTS Cytogenetic Map 17 q12.3 UniSTS
BE114499
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 73,334,356 - 73,334,526 (+) MAPPER mRatBN7.2 Rnor_6.0 17 77,292,480 - 77,292,649 NCBI Rnor6.0 Rnor_5.0 17 78,958,298 - 78,958,467 UniSTS Rnor5.0 RGSC_v3.4 17 84,423,071 - 84,423,240 UniSTS RGSC3.4 Celera 17 72,774,928 - 72,775,097 UniSTS RH 3.4 Map 17 729.8 UniSTS Cytogenetic Map 17 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024362 ⟹ ENSRNOP00000024362
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 73,329,082 - 73,346,409 (-) Ensembl Rnor_6.0 Ensembl 17 77,287,188 - 77,304,530 (-) Ensembl
RefSeq Acc Id:
NM_053674 ⟹ NP_446126
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 78,238,747 - 78,255,645 (-) NCBI mRatBN7.2 17 73,329,461 - 73,346,359 (-) NCBI Rnor_6.0 17 77,287,580 - 77,304,482 (-) NCBI Rnor_5.0 17 78,953,400 - 78,970,299 (-) NCBI RGSC_v3.4 17 84,418,173 - 84,435,073 (-) RGD Celera 17 72,770,062 - 72,786,946 (-) RGD
Sequence:
GGCCCCCACCATGGACTATACGCGCGCTGGTGCCCGGCTGCAGGTCCTTCTGGGACACCTTGGCCGACCCTCGGCCCTTCAGATTGTAGCCCACCCCGTATCAGGGCCGGCTTCCCCTGCCAATTTCT
hide sequence
RefSeq Acc Id:
NP_446126 ⟸ NM_053674
- Peptide Label:
precursor
- UniProtKB:
Q9QY64 (UniProtKB/Swiss-Prot), P57093 (UniProtKB/Swiss-Prot), A6JLZ6 (UniProtKB/TrEMBL)
- Sequence:
MDYTRAGARLQVLLGHLGRPSALQIVAHPVSGPASPANFCPEQFQYTLDNNVLSLEQRKFYEENGFLVIKNLVSDDDIQRFRAEFERICRKEVKPPGMTVMKDVAIAKQGYAPSERVVTKIQDFQQNE
hide sequence
Ensembl Acc Id:
ENSRNOP00000024362 ⟸ ENSRNOT00000024362
RGD ID: 13700574 Promoter ID: EPDNEW_R11098 Type: multiple initiation site Name: Phyh_1 Description: phytanoyl-CoA 2-hydroxylase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 77,304,489 - 77,304,549 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-11-06
Phyh
phytanoyl-CoA 2-hydroxylase
Phyh
phytanoyl-CoA hydroxylase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Phyh
phytanoyl-CoA hydroxylase
phytanoyl-CoA hydroxylase (Refsum disease)
Name updated
1299863 APPROVED
2002-08-07
Phyh
phytanoyl-CoA hydroxylase (Refsum disease)
Symbol and Name status set to provisional
70820 PROVISIONAL
