Advanced Search (OLGA)

Gene: Trim63 (tripartite motif containing 63) Rattus norvegicus

Analyze

Symbol:

Trim63

Name:

tripartite motif containing 63

RGD ID:

619964

Description:

Enables ubiquitin-protein transferase activity. Involved in several processes, including regulation of muscle adaptation; response to interleukin-1; and skeletal muscle atrophy. Acts upstream of or within muscle contraction. Located in contractile muscle fiber. Used to study muscular dystrophy. Biomarker of muscular atrophy and muscular dystrophy. Orthologous to human TRIM63 (tripartite motif containing 63); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E3 ubiquitin-protein ligase TRIM63; Murf; MURF-1; Murf1; muscle ring finger protein 1; muscle-specific RING finger protein 1; ring finger protein 28; RING-type E3 ubiquitin transferase TRIM63; Rnf28; tripartite motif containing 63, E3 ubiquitin protein ligase; tripartite motif protein 63; tripartite motif-containing 63; tripartite motif-containing protein 63

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRIM63 (tripartite motif containing 63)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Trim63 (tripartite motif-containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Trim63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRIM63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRIM63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trim63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TRIM63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRIM63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trim63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Trim63 (tripartite motif containing 63)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TRIM63 (tripartite motif containing 63)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trim63 (tripartite motif-containing 63)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	trim63a (tripartite motif containing 63a)	Alliance	DIOPT (Ensembl Compara\|OMA)
Danio rerio (zebrafish):	trim63b (tripartite motif containing 63b)	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	Y47G6A.14	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	trim63	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Trim63^em1(hiLuc)

Genetic Models:

SD-Trim63^em1(hiLuc)/Rrrc

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,817,209 - 151,831,026 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	151,817,225 - 151,831,058 (+)	Ensembl				GRCr8
mRatBN7.2	5	146,533,492 - 146,547,332 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	146,533,507 - 146,547,322 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	149,235,082 - 149,248,910 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	151,005,655 - 151,019,448 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,991,304 - 151,005,134 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	152,533,362 - 152,547,138 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	152,533,349 - 152,547,179 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	156,292,566 - 156,306,092 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	153,059,573 - 153,073,907 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	144,951,021 - 144,964,729 (+)	NCBI		Celera
RGSC_v3.1	5	153,069,611 - 153,083,946 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Atrophy (ISO)

Cardiomegaly (ISO)

cardiomyopathy (ISO)

familial hypertrophic cardiomyopathy (ISO)

genetic disease (ISO)

hypertrophic cardiomyopathy (ISO)

hypertrophic cardiomyopathy 1 (ISO)

hypertrophic cardiomyopathy 31 (ISO)

muscular atrophy (IEP,ISO)

muscular dystrophy (IEP,IMP)

primary pulmonary hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO)

6alpha-methylprednisolone (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Botulinum toxin type A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cantharidin (ISO)

chloroquine (EXP)

chlorpyrifos (ISO)

chromium atom (EXP)

cisplatin (ISO)

cobalt dichloride (ISO)

D-glucose (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

doxorubicin (EXP,ISO)

empagliflozin (EXP)

endosulfan (EXP)

epalrestat (ISO)

epoxiconazole (ISO)

fenofibrate (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glucose (ISO)

graphite (EXP)

hexadecanoic acid (ISO)

hydrogen cyanide (ISO)

imiquimod (ISO)

lipopolysaccharide (ISO)

lithocholic acid (ISO)

lovastatin (ISO)

LY294002 (ISO)

MeIQx (ISO)

methamphetamine (ISO)

nevirapine (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

ouabain (ISO)

ozone (ISO)

paraquat (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

potassium cyanide (ISO)

prednisolone (ISO)

progesterone (EXP)

quercetin (ISO)

resveratrol (ISO)

simvastatin (EXP,ISO)

sirtinol (ISO)

sotorasib (ISO)

tamoxifen (ISO)

testosterone (EXP,ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to dexamethasone stimulus (ISO)

innate immune response (IBA)

muscle contraction (IDA)

myotube cell development (ISO)

negative regulation of cardiac muscle hypertrophy (IMP)

negative regulation of glycolytic process (IEA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO)

protein monoubiquitination (ISO)

protein ubiquitination (IEA)

regulation of gene expression (ISO)

response to denervation involved in regulation of muscle adaptation (ISO)

response to electrical stimulus involved in regulation of muscle adaptation (IDA)

response to glucocorticoid (IEP)

response to interleukin-1 (IEP)

skeletal muscle atrophy (IEP)

Cellular Component

contractile muscle fiber (IDA)

Cul4-RING E3 ubiquitin ligase complex (ISO)

cytoplasm (IBA,IEA,ISO)

M band (IEA,ISO,ISS)

nucleus (IEA)

ubiquitin ligase complex (NAS)

Z disc (IEA,ISO,ISS)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

titin binding (IEA,ISO)

transferase activity (IEA)

ubiquitin protein ligase activity (IBA,IEA,ISO,ISS)

ubiquitin-protein transferase activity (IDA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Skeletal muscle dysfunction in idiopathic pulmonary arterial hypertension.	Batt J, etal., Am J Respir Cell Mol Biol. 2014 Jan;50(1):74-86. doi: 10.1165/rcmb.2012-0506OC.
2.	Identification of ubiquitin ligases required for skeletal muscle atrophy.	Bodine SC, etal., Science 2001 Nov 23;294(5547):1704-8.
3.	Induction of MafBx and Murf ubiquitin ligase mRNAs in rat skeletal muscle after LPS injection.	Dehoux MJ, etal., FEBS Lett 2003 Jun 5;544(1-3):214-7.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Muscle-specific RING finger 1 is a bona fide ubiquitin ligase that degrades cardiac troponin I.	Kedar V, etal., Proc Natl Acad Sci U S A. 2004 Dec 28;101(52):18135-40. Epub 2004 Dec 15.
6.	Noninvasive imaging of in vivo MuRF1 expression during muscle atrophy.	Li W, etal., PLoS One. 2014 Apr 7;9(4):e94032. doi: 10.1371/journal.pone.0094032. eCollection 2014.
7.	Myogenin regulates denervation-dependent muscle atrophy in mouse soleus muscle.	Macpherson PC, etal., J Cell Biochem. 2011 Aug;112(8):2149-59. doi: 10.1002/jcb.23136.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	The miR-19a/b family positively regulates cardiomyocyte hypertrophy by targeting atrogin-1 and MuRF-1.	Song DW, etal., Biochem J. 2014 Jan 1;457(1):151-62. doi: 10.1042/BJ20130833.
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11927605	PMID:12672461	PMID:14718385	PMID:15489334	PMID:15596539	PMID:15802564	PMID:15963672	PMID:16949134	PMID:17622304	PMID:17916612	PMID:18615595	PMID:18644837
PMID:19211729	PMID:19777444	PMID:19803207	PMID:19850579	PMID:20349269	PMID:20555375	PMID:21097394	PMID:21620866	PMID:21764995	PMID:21826997	PMID:21921267	PMID:22328594
PMID:22702057	PMID:22854904	PMID:23084640	PMID:23752591	PMID:23866982	PMID:24084216	PMID:24553183	PMID:25868327	PMID:26691660	PMID:26862156	PMID:27378730	PMID:28000044
PMID:28246104	PMID:29271608	PMID:30312703	PMID:32421985	PMID:32646070	PMID:34943780	PMID:35301823	PMID:36414561	PMID:37658726

Genomics

Comparative Map Data

Trim63
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,817,209 - 151,831,026 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	151,817,225 - 151,831,058 (+)	Ensembl				GRCr8
mRatBN7.2	5	146,533,492 - 146,547,332 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	146,533,507 - 146,547,322 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	149,235,082 - 149,248,910 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	151,005,655 - 151,019,448 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,991,304 - 151,005,134 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	152,533,362 - 152,547,138 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	152,533,349 - 152,547,179 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	156,292,566 - 156,306,092 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	153,059,573 - 153,073,907 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	144,951,021 - 144,964,729 (+)	NCBI		Celera
RGSC_v3.1	5	153,069,611 - 153,083,946 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

TRIM63
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	26,051,301 - 26,067,630 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	26,051,301 - 26,068,436 (-)	Ensembl			hg38	GRCh38
GRCh37	1	26,377,792 - 26,394,121 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	26,250,385 - 26,266,708 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	26,061,939 - 26,078,263	NCBI
Celera	1	24,774,477 - 24,790,800 (-)	NCBI		Celera
Cytogenetic Map	1	p36.11	NCBI
HuRef	1	24,631,910 - 24,648,243 (-)	NCBI		HuRef
CHM1_1	1	26,491,024 - 26,507,354 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	25,888,705 - 25,905,036 (-)	NCBI		T2T-CHM13v2.0

Trim63
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	134,042,431 - 134,056,940 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	134,042,431 - 134,056,940 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	134,315,120 - 134,329,629 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	134,315,120 - 134,329,629 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	133,871,035 - 133,885,544 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	133,587,300 - 133,599,849 (+)	NCBI		MGSCv36	mm8
MGSCv36	4	131,890,695 - 131,903,401 (+)	NCBI		MGSCv36	mm8
Celera	4	132,494,119 - 132,532,748 (+)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI
cM Map	4	66.58	NCBI

Trim63
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	5,520,269 - 5,531,975 (-)	Ensembl
ChiLan1.0	NW_004955452	5,517,969 - 5,531,490 (-)	NCBI	ChiLan1.0	ChiLan1.0

TRIM63
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	200,803,361 - 200,822,764 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	199,901,170 - 199,921,975 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	25,309,949 - 25,373,658 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	26,375,950 - 26,392,181 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	26,378,373 - 26,392,041 (-)	Ensembl			panPan2	panpan1.1

TRIM63
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	73,841,868 - 73,918,371 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	73,888,689 - 73,909,414 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	70,438,074 - 70,494,650 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	74,424,585 - 74,481,266 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	74,459,986 - 74,472,864 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	71,248,854 - 71,304,886 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	72,254,742 - 72,311,207 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	73,258,494 - 73,315,066 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Trim63
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	44,773,779 - 44,810,443 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	10,598,561 - 10,633,001 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	10,598,571 - 10,610,197 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRIM63
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	83,492,633 - 83,507,502 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	83,493,200 - 83,507,471 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	77,129,128 - 77,143,413 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRIM63
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	106,676,299 - 106,714,394 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	106,703,949 - 106,716,656 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	9,699,250 - 9,763,031 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trim63
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	10,128,751 - 10,139,687 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624764	10,126,345 - 10,139,829 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Trim63
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	23,916,950 - 23,931,001 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Trim63
44 total Variants

miRNA Target Status (No longer updated)

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir27a	rno-miR-27a-3p	Mirtarbase	external_info	Luciferase reporter assay	Non-Functional MTI	19574461
Mir23a	rno-miR-23a-3p	Mirtarbase	external_info	Luciferase reporter assay//qRT-PCR//Western blot	Functional MTI	19574461

Predicted Target Of

	Summary Value
Count of predictions:	274
Count of miRNA genes:	178
Interacting mature miRNAs:	213
Transcripts:	ENSRNOT00000067524
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	149805999	162987697	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Genetic Models

This gene Trim63 is modified in the following models/strains:

SD-Trim63^em1(hiLuc)/Rrrc

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	12	67	158	73	72	41	33	41	6	273	133	11	130	81	91	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY059627	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067524 ⟹ ENSRNOP00000058869

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	151,817,225 - 151,831,058 (+)	Ensembl
mRatBN7.2 Ensembl	5	146,533,517 - 146,547,322 (+)	Ensembl
Rnor_6.0 Ensembl	5	152,533,349 - 152,547,179 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112597 ⟹ ENSRNOP00000080013

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	151,817,225 - 151,827,607 (+)	Ensembl
mRatBN7.2 Ensembl	5	146,533,507 - 146,543,888 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000143635 ⟹ ENSRNOP00000108805

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	151,817,225 - 151,831,051 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151457 ⟹ ENSRNOP00000109681

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	151,817,225 - 151,830,316 (+)	Ensembl

RefSeq Acc Id:

NM_080903 ⟹ NP_543179

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,817,236 - 151,831,026 (+)	NCBI
mRatBN7.2	5	146,533,517 - 146,547,307 (+)	NCBI
Rnor_6.0	5	152,533,362 - 152,547,138 (+)	NCBI
Rnor_5.0	5	156,292,566 - 156,306,092 (+)	NCBI
RGSC_v3.4	5	153,059,573 - 153,073,907 (+)	RGD
Celera	5	144,951,021 - 144,964,729 (+)	RGD

Sequence:

show sequence

AAAGGTTCGGGGAGGAAGACAAAGAGGATCCGAGTGGGATCCCTTCCACTCGGTGTGACGCAGG
TGGAAGAGACAGTCGCAGTTTCGAAGCAATATGGATTATAAATCTGGCTTGATTCCGGACGGAA
ATGCTATGGAGAACCTGGAGAAGCAGCTCATCTGCCCCATCTGCCTTGAGATGTTTACCAAGCC
TGTGGTCATCCTGCCCTGCCAGCACAACCTCTGCCGGAAGTGTGCCAACGACATCTTCCAGGCT
GCCAATCCCTACTGGACCAACCGCGGTGGCTCGGTGTCCATGTCTGGAGGTCGTTTCCGCTGCC
CCTCGTGCCGCCATGAAGTGATCATGGACCGGCATGGGGTGTACGGTCTGCAGAGGAACCTGCT
GGTGGAGAACATCATCGACATCTACAAGCAGGAATGCTCCAGTCGGCCCCTGCAGAAAGGCAGC
CACCCGATGTGCAAGGAACACGAAGACGAGAAAATCAACATCTACTGTCTCACGTGCGAGGTGC
CTACTTGCTCCTTGTGCAAGGTGTTCGGGGCTCACCAGGCCTGTGAAGTTGCCCCCTTACAAAG
CATCTTCCAAGGACAGAAGACTGAACTGAGCAATTGCATCTCCATGCTGGTGGCAGGGAACGAC
CGAGTTCAGACTATCATCTCGCAGCTGGAGGACTCCTGCCGAGTGACCAAGGAAAACAGCCACC
AGGTGAAGGAGGAACTGAGCCACAAGTTTGACGCCCTCTACGCCATCCTGGACGAGAAGAAGAG
TGAGCTGCTGCAGCGGATCACTCAGGAGCAGGAGGAGAAGCTGGACTTCATCGAGGCCCTGATC
CTCCAGTACCGAGAGCAGTTGGAAAAGTCGACCAAGCTTGTGGAAACAGCCATCCAGTCCCTGG
ATGAGCCCGGAGGGGCCACCTTCCTCTTGAGTGCCAAGCCGCTCATCAAGAGCATTGTAGAAGC
TTCCAAGGGCTGCCAGCTGGGGAAGACAGAACAAGGCTTTGAGAACATGGACTACTTTACTCTG
AATTTAGAACACATAGCAGAGGCCTTGAGGGCCATCGACTTTGGGACAGATGAGGAGGAGGAGT
TTACTGAAGAGGAGGAGGAGGAGGATCAAGAAGAGGGCGTGTCCACAGAGGGACACCAATGAAG
AACTGGATGAGTGAGACGCCCTCTGGATGCAGAGATGGGGGAGGGGCGGGACAGGCCCATCTCG
GGATGGGGTTAGGGCTCCTTGGGGGCACCATAGGGAAGTGTGTCTTCTCTCTGCTCAGAGAGCA
GGGACTAGCATAGAAGCCCCACCATTGTGTCCAGCAGCTGCTGAAACACGATTGGAAATGTATC
CAAAAATGTCCCAGGACACTTTTTTACGTTGGTGCAAAATGAAATATTTTGTATGTTTTTAAAA
TGTGATTTTTGTATAAACTTGTATATGTATGCCAATTTGGTGCTTTTTGTACAAGAACTTTTGT
ATGATCATGCCTGGTCATTGTGTGACCAGCGATTGTCACAAAGGGGGAAGGAAGCCAAGTTCAT
TGAGCTGCCCACTTCCTTTCCTTGGCGGGAGGGTTGGGTCTCACTCAAAGGCCTAGAAAGGGGC
AATGTACTGTACTTCAGTACCCATCCCCAAACACGGGGAGAGGACTGAATTTGTGTTATATGTT
GTTTTAATAAATGCAGAAGGGGCTGGGTATTGGGGGTGCACACCCTTTGATCCCAGCACTCTGG
AGGCAGAGGCAGTTGGATCTCTATGAGTTCGAGGCTAGCCTGGTCTACATGGAGAGTTCCAGAC
CAGCCAGGGCAACATAGAGAGACTTTCTGTCTCAAAAATAAAAAAATAAAAAACTTTCCAGCAC
AATGG

hide sequence

RefSeq Acc Id:

XM_039109192 ⟹ XP_038965120

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,817,209 - 151,831,026 (+)	NCBI
mRatBN7.2	5	146,533,492 - 146,547,332 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_543179	(Get FASTA)	NCBI Sequence Viewer
	XP_038965120	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61824	(Get FASTA)	NCBI Sequence Viewer
	AAL16405	(Get FASTA)	NCBI Sequence Viewer
	EDL80717	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000058869
	ENSRNOP00000058869.1
GenBank Protein	Q91Z63	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_543179 ⟸ NM_080903

- UniProtKB:

Q91Z63 (UniProtKB/Swiss-Prot), A6IT16 (UniProtKB/TrEMBL), A0A8I5ZNP7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDYKSGLIPDGNAMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWTNRGG
SVSMSGGRFRCPSCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHPMCKEHEDE
KINIYCLTCEVPTCSLCKVFGAHQACEVAPLQSIFQGQKTELSNCISMLVAGNDRVQTIISQLE
DSCRVTKENSHQVKEELSHKFDALYAILDEKKSELLQRITQEQEEKLDFIEALILQYREQLEKS
TKLVETAIQSLDEPGGATFLLSAKPLIKSIVEASKGCQLGKTEQGFENMDYFTLNLEHIAEALR
AIDFGTDEEEEFTEEEEEEDQEEGVSTEGHQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000058869 ⟸ ENSRNOT00000067524

RefSeq Acc Id:	XP_038965120 ⟸ XM_039109192
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZNP7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000080013 ⟸ ENSRNOT00000112597

Ensembl Acc Id:

ENSRNOP00000109681 ⟸ ENSRNOT00000151457

Ensembl Acc Id:

ENSRNOP00000108805 ⟸ ENSRNOT00000143635

Protein Domains

B box-type COS RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91Z63-F1-model_v2	AlphaFold	Q91Z63	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694134

Promoter ID:

EPDNEW_R4659

Type:

single initiation site

Name:

Trim63_1

Description:

tripartite motif containing 63

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	152,533,351 - 152,533,411	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619964	AgrOrtholog
BioCyc Gene	G2FUF-39582	BioCyc
Ensembl Genes	ENSRNOG00000016543	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000067524	ENTREZGENE
	ENSRNOT00000067524.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
	3.30.40.10	UniProtKB/Swiss-Prot
	Classic Zinc Finger	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5599072	IMAGE-MGC_LOAD
InterPro	COS_domain	UniProtKB/Swiss-Prot
	E3_ligase_FN3/SPRY	UniProtKB/Swiss-Prot
	TRIM63_RING-HC	UniProtKB/Swiss-Prot
	Znf-RING_LisH	UniProtKB/Swiss-Prot
	Znf_B-box	UniProtKB/Swiss-Prot
	Znf_RING	UniProtKB/Swiss-Prot
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot
	Znf_RING_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:140939	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72330	IMAGE-MGC_LOAD
NCBI Gene	140939	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE TRIM36-RELATED	UniProtKB/Swiss-Prot
	TRIPARTITE MOTIF CONTAINING 55	UniProtKB/Swiss-Prot
Pfam	zf-B_box	UniProtKB/Swiss-Prot
	zf-RING_UBOX	UniProtKB/Swiss-Prot
PhenoGen	Trim63	PhenoGen
PROSITE	COS	UniProtKB/Swiss-Prot
	ZF_BBOX	UniProtKB/Swiss-Prot
	ZF_RING_1	UniProtKB/Swiss-Prot
	ZF_RING_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016543	RatGTEx
SMART	BBOX	UniProtKB/Swiss-Prot
	RING	UniProtKB/Swiss-Prot
Superfamily-SCOP	B-box zinc-binding domain	UniProtKB/Swiss-Prot
	RING/U-box	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZNP7	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0M0U3_RAT	UniProtKB/TrEMBL
	A0ABK0M1G3_RAT	UniProtKB/TrEMBL
	A6IT16	ENTREZGENE, UniProtKB/TrEMBL
	Q91Z63	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Trim63	tripartite motif containing 63	Trim63	tripartite motif containing 63, E3 ubiquitin protein ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Trim63	tripartite motif containing 63, E3 ubiquitin protein ligase	Trim63	tripartite motif-containing 63	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Trim63	tripartite motif-containing 63	Trim63	tripartite motif protein 63	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Trim63	tripartite motif protein 63		tripartite motif-containing 63	Name updated	1299863	APPROVED
2005-01-20	Trim63	tripartite motif-containing 63	Rnf28	ring finger protein 28	Symbol and Name updated	1299863	APPROVED
2002-08-07	Rnf28	ring finger protein 28			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM