Symbol:
Ddr2
Name:
discoidin domain receptor tyrosine kinase 2
RGD ID:
619855
Description:
Enables collagen binding activity. Involved in several processes, including negative regulation of programmed cell death; positive regulation of ERK1 and ERK2 cascade; and positive regulation of cell population proliferation. Located in apical plasma membrane. Used to study alcoholic liver cirrhosis. Biomarker of alcoholic liver cirrhosis. Human ortholog(s) of this gene implicated in bone disease (multiple) and gastrointestinal system cancer (multiple). Orthologous to human DDR2 (discoidin domain receptor tyrosine kinase 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3-methylcholanthrene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CD167b antigen; discoidin domain receptor family, member 2; discoidin domain-containing receptor 2; LOC360265; LOC685781; neurotrophic tyrosine kinase, receptor-related 3; receptor protein-tyrosine kinase TKT; similar to Discoidin domain-containing receptor 2 precursor (Discoidin domain receptor 2) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO 10) (Neurotrophic tyrosine kinase, receptor-related 3) (CD167b antigen); Tyro10; tyrosine-protein kinase TYRO 10
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DDR2 (discoidin domain receptor tyrosine kinase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ddr2 (discoidin domain receptor family, member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ddr2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DDR2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DDR2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ddr2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DDR2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DDR2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ddr2 (discoidin domain receptor tyrosine kinase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FMN2 (formin 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
DDR2 (discoidin domain receptor tyrosine kinase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ddr2 (discoidin domain receptor family, member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ddr2a (discoidin domain receptor tyrosine kinase 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ddr2b (discoidin domain receptor tyrosine kinase 2b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Ddr
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ddr-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
smal
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ddr2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
ddr2l
Alliance
DIOPT (InParanoid|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 84,726,412 - 84,851,032 (-) NCBI GRCr8 mRatBN7.2 13 82,193,623 - 82,318,229 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 82,195,463 - 82,317,363 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 84,825,759 - 84,870,742 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 86,118,972 - 86,164,115 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 83,350,999 - 83,395,987 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 88,311,639 - 88,436,561 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 88,317,145 - 88,436,789 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 92,937,900 - 93,062,655 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 85,801,449 - 85,846,636 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 85,816,366 - 85,822,349 (-) NCBI Celera 13 81,860,445 - 81,905,616 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ddr2 Rat 17alpha-ethynylestradiol affects expression ISO Ddr2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of DDR2 mRNA CTD PMID:17555576 Ddr2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ddr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ddr2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Ddr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ddr2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ddr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DDR2 mRNA CTD PMID:21570461 Ddr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DDR2 mRNA CTD PMID:34747641 Ddr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ddr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DDR2 mRNA CTD PMID:33956508 Ddr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DDR2 mRNA CTD PMID:32109520 Ddr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ddr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DDR2 mRNA CTD PMID:15034205 Ddr2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ddr2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ddr2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ddr2 Rat 2-butoxyethanol decreases expression ISO Ddr2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of DDR2 mRNA CTD PMID:19812364 Ddr2 Rat 2-methylcholine affects expression ISO DDR2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of DDR2 mRNA CTD PMID:21179406 Ddr2 Rat 3-methylcholanthrene multiple interactions EXP 6480464 alpha-naphthoflavone inhibits the reaction [Methylcholanthrene results in increased expression of DDR2 mRNA] CTD PMID:29094188 Ddr2 Rat 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of DDR2 mRNA CTD PMID:29094188 Ddr2 Rat 3-Nitrobenzanthrone affects expression ISO DDR2 (Homo sapiens) 6480464 3-nitrobenzanthrone affects the expression of DDR2 mRNA CTD PMID:34036453 Ddr2 Rat 4,4'-sulfonyldiphenol increases expression ISO Ddr2 (Mus musculus) 6480464 bisphenol S results in increased expression of DDR2 mRNA CTD PMID:30951980 Ddr2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DDR2 mRNA CTD PMID:36041667 Ddr2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Ddr2 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of DDR2 mRNA CTD PMID:30951980 Ddr2 Rat 4-hydroxynon-2-enal decreases expression ISO DDR2 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of DDR2 mRNA CTD PMID:12419474 Ddr2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of DDR2 mRNA CTD PMID:24780913 Ddr2 Rat acetaldehyde increases expression EXP 150517731 Acetaldehyde increases expression of Ddr2 protein expression in hepatic stellate cells RGD Ddr2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of DDR2 mRNA CTD PMID:28959563 Ddr2 Rat acrylamide increases expression ISO DDR2 (Homo sapiens) 6480464 Acrylamide results in increased expression of DDR2 mRNA CTD PMID:32763439 Ddr2 Rat all-trans-retinoic acid increases expression ISO DDR2 (Homo sapiens) 6480464 Tretinoin results in increased expression of DDR2 mRNA and Tretinoin results in increased expression of DDR2 protein CTD PMID:21934132 and PMID:30093655 Ddr2 Rat all-trans-retinoic acid multiple interactions ISO Ddr2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of DDR2 mRNA more ... CTD PMID:30951980 Ddr2 Rat alpha-naphthoflavone multiple interactions EXP 6480464 alpha-naphthoflavone inhibits the reaction [Methylcholanthrene results in increased expression of DDR2 mRNA] CTD PMID:29094188 Ddr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DDR2 mRNA CTD PMID:16483693 Ddr2 Rat antirheumatic drug increases expression ISO DDR2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DDR2 mRNA CTD PMID:24449571 Ddr2 Rat aripiprazole decreases expression EXP 6480464 Aripiprazole results in decreased expression of DDR2 mRNA CTD PMID:17868501 Ddr2 Rat arsenous acid increases expression ISO DDR2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of DDR2 protein CTD PMID:30093655 Ddr2 Rat atrazine increases expression ISO DDR2 (Homo sapiens) 6480464 Atrazine results in increased expression of DDR2 mRNA CTD PMID:22378314 Ddr2 Rat Azoxymethane multiple interactions ISO Ddr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DDR2 mRNA CTD PMID:29950665 Ddr2 Rat benzo[a]pyrene decreases expression ISO Ddr2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DDR2 mRNA CTD PMID:15034205 Ddr2 Rat benzo[a]pyrene decreases expression ISO DDR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DDR2 mRNA CTD PMID:32234424 Ddr2 Rat benzo[a]pyrene affects methylation ISO DDR2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DDR2 5' UTR and Benzo(a)pyrene affects the methylation of DDR2 exon CTD PMID:27901495 Ddr2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DDR2 mRNA CTD PMID:25181051 Ddr2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DDR2 mRNA CTD PMID:36041667 Ddr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DDR2 mRNA CTD PMID:30816183 more ... Ddr2 Rat bisphenol A increases expression ISO Ddr2 (Mus musculus) 6480464 bisphenol A results in increased expression of DDR2 mRNA CTD PMID:30951980 Ddr2 Rat bisphenol A increases expression ISO DDR2 (Homo sapiens) 6480464 bisphenol A results in increased expression of DDR2 mRNA CTD PMID:29275510 Ddr2 Rat bisphenol A multiple interactions ISO Ddr2 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of DDR2 mRNA CTD PMID:30951980 Ddr2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DDR2 gene CTD PMID:28505145 Ddr2 Rat bisphenol AF increases expression ISO DDR2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DDR2 protein CTD PMID:34186270 Ddr2 Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of DDR2 mRNA CTD PMID:27567155 Ddr2 Rat bisphenol F multiple interactions ISO Ddr2 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of DDR2 mRNA CTD PMID:30951980 Ddr2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DDR2 mRNA CTD PMID:36041667 Ddr2 Rat bisphenol F decreases expression ISO Ddr2 (Mus musculus) 6480464 bisphenol F results in decreased expression of DDR2 mRNA CTD PMID:38685157 Ddr2 Rat bisphenol F increases expression ISO Ddr2 (Mus musculus) 6480464 bisphenol F results in increased expression of DDR2 mRNA CTD PMID:30951980 Ddr2 Rat carbon nanotube decreases expression ISO Ddr2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ddr2 Rat carbon nanotube decreases expression ISO DDR2 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of DDR2 mRNA CTD PMID:28673683 Ddr2 Rat CGP 52608 multiple interactions ISO DDR2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DDR2 gene] CTD PMID:28238834 Ddr2 Rat chlordecone increases expression ISO Ddr2 (Mus musculus) 6480464 Chlordecone results in increased expression of DDR2 mRNA CTD PMID:33711761 Ddr2 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of DDR2 mRNA CTD PMID:23125180 Ddr2 Rat chlorpyrifos increases expression ISO Ddr2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DDR2 mRNA CTD PMID:34289071 Ddr2 Rat cisplatin multiple interactions ISO DDR2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of DDR2 mRNA CTD PMID:27392435 Ddr2 Rat cisplatin decreases expression ISO DDR2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DDR2 mRNA CTD PMID:27392435 Ddr2 Rat cobalt dichloride decreases expression ISO DDR2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DDR2 mRNA CTD PMID:19320972 Ddr2 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of DDR2 mRNA CTD PMID:17898221 Ddr2 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of DDR2 mRNA CTD PMID:30556269 Ddr2 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of DDR2 mRNA CTD PMID:30556269 Ddr2 Rat crocidolite asbestos decreases expression ISO Ddr2 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of DDR2 mRNA CTD PMID:29279043 Ddr2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DDR2 mRNA CTD PMID:26577399 Ddr2 Rat cyclosporin A increases expression ISO DDR2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DDR2 mRNA CTD PMID:20106945 Ddr2 Rat cytarabine decreases expression ISO DDR2 (Homo sapiens) 6480464 Cytarabine results in decreased expression of DDR2 mRNA CTD PMID:21198554 Ddr2 Rat DDE decreases expression ISO DDR2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of DDR2 mRNA CTD PMID:38568856 Ddr2 Rat dextran sulfate multiple interactions ISO Ddr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DDR2 mRNA CTD PMID:29950665 Ddr2 Rat diarsenic trioxide increases expression ISO DDR2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of DDR2 protein CTD PMID:30093655 Ddr2 Rat diquat decreases expression ISO Ddr2 (Mus musculus) 6480464 Diquat results in decreased expression of DDR2 mRNA CTD PMID:36851058 Ddr2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of DDR2 mRNA CTD PMID:25152437 Ddr2 Rat dorsomorphin multiple interactions ISO DDR2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ddr2 Rat doxorubicin decreases expression ISO DDR2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DDR2 mRNA CTD PMID:29803840 Ddr2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of DDR2 mRNA CTD PMID:29391264 Ddr2 Rat ethanol increases expression ISO Ddr2 (Mus musculus) 6480464 Ethanol results in increased expression of DDR2 mRNA CTD PMID:30319688 Ddr2 Rat ethanol increases expression EXP 150517731 Ethanol increases expression of Ddr2 protein expression in the liver RGD Ddr2 Rat ethyl methanesulfonate decreases expression ISO DDR2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of DDR2 mRNA CTD PMID:23649840 Ddr2 Rat fenamidone increases expression ISO Ddr2 (Mus musculus) 6480464 fenamidone results in increased expression of DDR2 mRNA CTD PMID:27029645 Ddr2 Rat FR900359 decreases phosphorylation ISO DDR2 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of DDR2 protein CTD PMID:37730182 Ddr2 Rat furan increases expression EXP 6480464 furan results in increased expression of DDR2 mRNA CTD PMID:27387713 Ddr2 Rat geldanamycin increases expression ISO DDR2 (Homo sapiens) 6480464 geldanamycin results in increased expression of DDR2 mRNA CTD PMID:26705709 Ddr2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DDR2 mRNA CTD PMID:33387578 Ddr2 Rat hydrogen peroxide decreases expression ISO DDR2 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of DDR2 mRNA CTD PMID:12419474 Ddr2 Rat hydrogen peroxide affects expression ISO DDR2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of DDR2 mRNA CTD PMID:21179406 Ddr2 Rat inulin multiple interactions ISO Ddr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DDR2 mRNA CTD PMID:36331819 Ddr2 Rat iron dichloride increases expression ISO DDR2 (Homo sapiens) 6480464 ferrous chloride results in increased expression of DDR2 mRNA CTD PMID:35984750 Ddr2 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of DDR2 mRNA CTD PMID:22641619 Ddr2 Rat Licochalcone B increases expression ISO DDR2 (Homo sapiens) 6480464 licochalcone B results in increased expression of DDR2 mRNA CTD PMID:33647349 Ddr2 Rat lithium atom decreases expression ISO DDR2 (Homo sapiens) 6480464 Lithium results in decreased expression of DDR2 mRNA CTD PMID:21092101 Ddr2 Rat lithium hydride decreases expression ISO DDR2 (Homo sapiens) 6480464 Lithium results in decreased expression of DDR2 mRNA CTD PMID:21092101 Ddr2 Rat mercury dibromide increases expression ISO DDR2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of DDR2 mRNA CTD PMID:26272509 Ddr2 Rat mercury dibromide multiple interactions ISO DDR2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DDR2 mRNA CTD PMID:27188386 Ddr2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of DDR2 gene CTD PMID:35440735 Ddr2 Rat methyl methanesulfonate decreases expression ISO DDR2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DDR2 mRNA CTD PMID:23649840 Ddr2 Rat methylmercury chloride increases expression ISO DDR2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DDR2 mRNA CTD PMID:28001369 Ddr2 Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of DDR2 mRNA CTD PMID:25972201 Ddr2 Rat N-methyl-4-phenylpyridinium increases expression ISO DDR2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of DDR2 mRNA CTD PMID:24810058 Ddr2 Rat N-Nitrosopyrrolidine decreases expression ISO DDR2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of DDR2 mRNA CTD PMID:32234424 Ddr2 Rat nickel sulfate increases expression ISO DDR2 (Homo sapiens) 6480464 nickel sulfate results in increased expression of DDR2 mRNA CTD PMID:22714537 Ddr2 Rat O-methyleugenol decreases expression ISO DDR2 (Homo sapiens) 6480464 methyleugenol results in decreased expression of DDR2 mRNA CTD PMID:32234424 Ddr2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DDR2 mRNA CTD PMID:25729387 Ddr2 Rat p-chloromercuribenzoic acid increases expression ISO DDR2 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of DDR2 mRNA CTD PMID:26272509 Ddr2 Rat p-chloromercuribenzoic acid multiple interactions ISO DDR2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DDR2 mRNA CTD PMID:27188386 Ddr2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DDR2 mRNA CTD PMID:33387578 Ddr2 Rat PCB138 multiple interactions ISO Ddr2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ddr2 Rat perfluorohexanesulfonic acid increases expression ISO DDR2 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in increased expression of DDR2 mRNA CTD PMID:25812627 Ddr2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ddr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DDR2 mRNA CTD PMID:36331819 Ddr2 Rat perfluorooctane-1-sulfonic acid increases expression ISO DDR2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of DDR2 mRNA CTD PMID:25812627 Ddr2 Rat perfluorooctanoic acid increases expression ISO DDR2 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of DDR2 mRNA CTD PMID:25812627 Ddr2 Rat phenylmercury acetate increases expression ISO DDR2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DDR2 mRNA CTD PMID:26272509 Ddr2 Rat phenylmercury acetate multiple interactions ISO DDR2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DDR2 mRNA CTD PMID:27188386 Ddr2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of DDR2 mRNA CTD PMID:12832660 Ddr2 Rat ponatinib decreases activity ISO DDR2 (Homo sapiens) 6480464 ponatinib results in decreased activity of DDR2 protein CTD PMID:19878872 Ddr2 Rat potassium dichromate increases expression ISO Ddr2 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of DDR2 mRNA CTD PMID:23608068 Ddr2 Rat resveratrol decreases expression ISO DDR2 (Homo sapiens) 6480464 resveratrol results in decreased expression of DDR2 mRNA CTD PMID:25667456 Ddr2 Rat SB 431542 multiple interactions ISO DDR2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ddr2 Rat sodium arsenate decreases expression ISO Ddr2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of DDR2 mRNA CTD PMID:21795629 Ddr2 Rat sodium arsenate increases expression ISO Ddr2 (Mus musculus) 6480464 sodium arsenate results in increased expression of DDR2 mRNA CTD PMID:21795629 Ddr2 Rat sodium arsenite increases expression ISO DDR2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DDR2 mRNA CTD PMID:22714537 and PMID:38568856 Ddr2 Rat sunitinib increases expression ISO DDR2 (Homo sapiens) 6480464 Sunitinib results in increased expression of DDR2 mRNA CTD PMID:31533062 Ddr2 Rat tamoxifen affects expression ISO Ddr2 (Mus musculus) 6480464 Tamoxifen affects the expression of DDR2 mRNA CTD PMID:17555576 Ddr2 Rat tebuconazole decreases expression ISO DDR2 (Homo sapiens) 6480464 tebuconazole results in decreased expression of DDR2 mRNA CTD PMID:30458266 Ddr2 Rat temozolomide decreases expression ISO DDR2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DDR2 mRNA CTD PMID:31758290 Ddr2 Rat thapsigargin increases expression ISO Ddr2 (Mus musculus) 6480464 Thapsigargin results in increased expression of DDR2 protein CTD PMID:24648495 Ddr2 Rat thiram increases expression ISO DDR2 (Homo sapiens) 6480464 Thiram results in increased expression of DDR2 mRNA CTD PMID:38568856 Ddr2 Rat titanium dioxide decreases expression ISO Ddr2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of DDR2 mRNA CTD PMID:27760801 and PMID:35295148 Ddr2 Rat titanium dioxide multiple interactions ISO Ddr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DDR2 mRNA CTD PMID:29950665 Ddr2 Rat titanium dioxide increases expression ISO Ddr2 (Mus musculus) 6480464 titanium dioxide results in increased expression of DDR2 mRNA CTD PMID:29264374 Ddr2 Rat titanium dioxide multiple interactions ISO DDR2 (Homo sapiens) 6480464 [Vitallium analog binds to titanium dioxide] which results in increased expression of DDR2 mRNA CTD PMID:23825117 Ddr2 Rat titanium dioxide increases expression ISO DDR2 (Homo sapiens) 6480464 titanium dioxide results in increased expression of DDR2 mRNA CTD PMID:19695317 Ddr2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DDR2 mRNA CTD PMID:25729387 Ddr2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of DDR2 mRNA CTD PMID:25729387 Ddr2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DDR2 mRNA CTD PMID:33387578 Ddr2 Rat triptonide affects expression ISO Ddr2 (Mus musculus) 6480464 triptonide affects the expression of DDR2 mRNA CTD PMID:33045310 Ddr2 Rat valproic acid affects expression ISO DDR2 (Homo sapiens) 6480464 Valproic Acid affects the expression of DDR2 mRNA CTD PMID:25979313 Ddr2 Rat valproic acid increases expression ISO Ddr2 (Mus musculus) 6480464 Valproic Acid results in increased expression of DDR2 mRNA CTD PMID:24896083 Ddr2 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of DDR2 gene CTD PMID:31079544 Ddr2 Rat zidovudine multiple interactions ISO DDR2 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in decreased expression of DDR2 mRNA CTD PMID:20370541 Ddr2 Rat zinc atom multiple interactions ISO DDR2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of DDR2 mRNA CTD PMID:18593933 Ddr2 Rat zinc(0) multiple interactions ISO DDR2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of DDR2 mRNA CTD PMID:18593933
17alpha-ethynylestradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 2-methylcholine (ISO) 3-methylcholanthrene (EXP) 3-Nitrobenzanthrone (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) acetaldehyde (EXP) acrylamide (EXP,ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aripiprazole (EXP) arsenous acid (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP,ISO) bisphenol F (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chloroprene (EXP) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (ISO) DDE (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diquat (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) fenamidone (ISO) FR900359 (ISO) furan (EXP) geldanamycin (ISO) gentamycin (EXP) hydrogen peroxide (ISO) inulin (ISO) iron dichloride (ISO) lead diacetate (EXP) Licochalcone B (ISO) lithium atom (ISO) lithium hydride (ISO) mercury dibromide (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mifepristone (EXP) N-methyl-4-phenylpyridinium (ISO) N-Nitrosopyrrolidine (ISO) nickel sulfate (ISO) O-methyleugenol (ISO) oxaliplatin (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (EXP) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) ponatinib (ISO) potassium dichromate (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (ISO) tebuconazole (ISO) temozolomide (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zidovudine (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
biomineral tissue development (IEA,ISO) cell surface receptor protein tyrosine kinase signaling pathway (IBA,IEA,ISO) cellular response to angiotensin (IEP) cellular response to hypoxia (IEP) cellular response to transforming growth factor beta stimulus (IEP) chondrocyte proliferation (IEA,ISO) collagen fibril organization (IEA,ISO) collagen-activated tyrosine kinase receptor signaling pathway (IEA,ISO) endochondral bone growth (IEA,ISO) negative regulation of apoptotic process (IMP) negative regulation of hydrogen peroxide-mediated programmed cell death (IMP) negative regulation of kinase activity (IMP) peptidyl-tyrosine phosphorylation (ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of cellular process (IMP) positive regulation of collagen biosynthetic process (IDA,IMP) positive regulation of DNA-binding transcription factor activity (ISO) positive regulation of ERK1 and ERK2 cascade (IMP) positive regulation of extracellular matrix disassembly (IEA,ISO) positive regulation of fibroblast migration (IEA,ISO) positive regulation of fibroblast proliferation (IEA,ISO) positive regulation of G1/S transition of mitotic cell cycle (IMP) positive regulation of hepatic stellate cell activation (IMP) positive regulation of hepatic stellate cell proliferation (IMP) positive regulation of neuron projection development (IBA) positive regulation of osteoblast differentiation (IEA,ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IBA) positive regulation of protein kinase activity (ISO) positive regulation of vascular associated smooth muscle cell migration (IMP) positive regulation of vascular associated smooth muscle cell proliferation (IMP) positive regulation of wound healing (IMP) protein autophosphorylation (ISO) regulation of bone mineralization (IEA,ISO) regulation of tissue remodeling (IEA,ISO) response to muscle stretch (IEP)
1.
Binding of discoidin domain receptor 2 to collagen I: an atomic force microscopy investigation.
Agarwal G, etal., Biochemistry 2002 Sep 17;41(37):11091-8.
2.
Discoidin domain receptor 2 deficiency predisposes hepatic tissue to colon carcinoma metastasis.
Badiola I, etal., Gut. 2012 Oct;61(10):1465-72. doi: 10.1136/gutjnl-2011-300810. Epub 2011 Nov 9.
3.
Downregulation of discoidin domain receptor 2 in A375 human melanoma cells reduces its experimental liver metastasis ability.
Badiola I, etal., Oncol Rep. 2011 Oct;26(4):971-8. doi: 10.3892/or.2011.1356. Epub 2011 Jun 23.
4.
The relative roles of collagen adhesive receptor DDR2 activation and matrix stiffness on the downregulation of focal adhesion kinase in vascular smooth muscle cells.
Bhadriraju K, etal., Biomaterials. 2009 Dec;30(35):6687-94. doi: 10.1016/j.biomaterials.2009.08.036. Epub 2009 Sep 16.
5.
Hypoxia induces discoidin domain receptor-2 expression via the p38 pathway in vascular smooth muscle cells to increase their migration.
Chen SC, etal., Biochem Biophys Res Commun. 2008 Oct 3;374(4):662-7. doi: 10.1016/j.bbrc.2008.07.092. Epub 2008 Jul 26.
6.
Upregulation of discoidin domain receptor 2 in nasopharyngeal carcinoma.
Chua HH, etal., Head Neck. 2008 Apr;30(4):427-36. doi: 10.1002/hed.20724.
7.
Expression and mutation analysis of the discoidin domain receptors 1 and 2 in non-small cell lung carcinoma.
Ford CE, etal., Br J Cancer. 2007 Mar 12;96(5):808-14. doi: 10.1038/sj.bjc.6603614. Epub 2007 Feb 13.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Molecular basis and functional significance of Angiotensin II-induced increase in Discoidin Domain Receptor 2 gene expression in cardiac fibroblasts.
George M, etal., J Mol Cell Cardiol. 2016 Jan;90:59-69. doi: 10.1016/j.yjmcc.2015.12.004. Epub 2015 Dec 8.
10.
Discoidin domain receptor inhibition reduces neuropathology and attenuates inflammation in neurodegeneration models.
Hebron M, etal., J Neuroimmunol. 2017 Oct 15;311:1-9. doi: 10.1016/j.jneuroim.2017.07.009. Epub 2017 Aug 12.
11.
Integrated Molecular Profiling of Human Gastric Cancer Identifies DDR2 as a Potential Regulator of Peritoneal Dissemination.
Kurashige J, etal., Sci Rep. 2016 Mar 3;6:22371. doi: 10.1038/srep22371.
12.
Localization of discoidin domain receptors in rat kidney.
Lee R, etal., Nephron Exp Nephrol. 2004;97(2):e62-70.
13.
DDR2 and IFITM1 Are Prognostic Markers in Gallbladder Squamous Cell/Adenosquamous Carcinomas and Adenocarcinomas.
Li D, etal., Pathol Oncol Res. 2019 Jan;25(1):157-167. doi: 10.1007/s12253-017-0314-3. Epub 2017 Oct 17.
14.
Allogeneic adipose-derived stem cell transplantation on knee osteoarthritis rats and its effect on MMP-13 and DDR2.
Li J, etal., Exp Ther Med. 2019 Jul;18(1):99-104. doi: 10.3892/etm.2019.7554. Epub 2019 May 8.
15.
Amplification of DDR2 mediates sorafenib resistance through NF-κB/c-Rel signaling in hepatocellular carcinoma.
Liu QQ, etal., Cell Biol Int. 2021 Sep;45(9):1906-1916. doi: 10.1002/cbin.11625. Epub 2021 May 16.
16.
RNA interference against discoidin domain receptor 2 ameliorates alcoholic liver disease in rats.
Luo Z, etal., PLoS One. 2013;8(2):e55860. doi: 10.1371/journal.pone.0055860. Epub 2013 Feb 7.
17.
Identification of novel driver mutations of the discoidin domain receptor 2 (DDR2) gene in squamous cell lung cancer of Chinese patients.
Miao L, etal., BMC Cancer. 2014 May 24;14:369. doi: 10.1186/1471-2407-14-369.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
Effect of Bushenhuoxue formula on interleukin-1 beta and discoidin domain receptor 2 levels in a rat model of osteoarthritis.
Nianhu L, etal., J Tradit Chin Med. 2015 Apr;35(2):192-6. doi: 10.1016/s0254-6272(15)30027-3.
20.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
21.
GOA pipeline
RGD automated data pipeline
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
DDR2 polymorphisms and mRNA expression in lung cancers of Japanese patients.
Sasaki H, etal., Oncol Lett. 2012 Jul;4(1):33-37. doi: 10.3892/ol.2012.684. Epub 2012 Apr 18.
25.
DDR2 Expression Is Associated with a High Frequency of Peritoneal Dissemination and Poor Prognosis in Colorectal Cancer.
Sasaki S, etal., Anticancer Res. 2017 May;37(5):2587-2591. doi: 10.21873/anticanres.11603.
26.
Regulation of discoidin domain receptor 2 by cyclic mechanical stretch in cultured rat vascular smooth muscle cells.
Shyu KG, etal., Hypertension. 2005 Sep;46(3):614-21. doi: 10.1161/01.HYP.0000175811.79863.e2. Epub 2005 Aug 8.
27.
Coordinated regulation of cell survival and cell cycle pathways by DDR2-dependent SRF transcription factor in cardiac fibroblasts.
Titus AS, etal., Am J Physiol Heart Circ Physiol. 2020 Jun 1;318(6):H1538-H1558. doi: 10.1152/ajpheart.00740.2019. Epub 2020 May 15.
28.
DDR2 overexpression in oral squamous cell carcinoma is associated to lymph node metastasis.
Velmurugan BK, etal., Cancer Biomark. 2018;22(4):747-753. doi: 10.3233/CBM-181302.
29.
DDR2 Induces Gastric Cancer Cell Activities via Activating mTORC2 Signaling and Is Associated with Clinicopathological Characteristics of Gastric Cancer.
Wang YG, etal., Dig Dis Sci. 2016 Aug;61(8):2272-2283. doi: 10.1007/s10620-016-4116-3. Epub 2016 Mar 24.
30.
DDR2 facilitates hepatocellular carcinoma invasion and metastasis via activating ERK signaling and stabilizing SNAIL1.
Xie B, etal., J Exp Clin Cancer Res. 2015 Sep 11;34:101. doi: 10.1186/s13046-015-0218-6.
31.
Overexpression of DDR2 contributes to cell invasion and migration in head and neck squamous cell carcinoma.
Xu J, etal., Cancer Biol Ther. 2014 May;15(5):612-22. doi: 10.4161/cbt.28181. Epub 2014 Feb 20.
32.
A host deficiency of discoidin domain receptor 2 (DDR2) inhibits both tumour angiogenesis and metastasis.
Zhang S, etal., J Pathol. 2014 Mar;232(4):436-48. doi: 10.1002/path.4311.
33.
Experimental chondrocyte hypertrophy is promoted by the activation of discoidin domain receptor 2.
Zhang S, etal., Mol Med Rep. 2014 Sep;10(3):1543-8. doi: 10.3892/mmr.2014.2340. Epub 2014 Jun 17.
34.
Expression of discoidin domain receptors (DDR2) in alcoholic liver fibrosis in rats.
Zhang XH, etal., Arch Med Res. 2010 Nov;41(8):586-92. doi: 10.1016/j.arcmed.2010.10.010.
35.
The discoidin domain receptor 2/annexin A2/matrix metalloproteinase 13 loop promotes joint destruction in arthritis through promoting migration and invasion of fibroblast-like synoviocytes.
Zhao W, etal., Arthritis Rheumatol. 2014 Sep;66(9):2355-67. doi: 10.1002/art.38696.
Ddr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 84,726,412 - 84,851,032 (-) NCBI GRCr8 mRatBN7.2 13 82,193,623 - 82,318,229 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 82,195,463 - 82,317,363 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 84,825,759 - 84,870,742 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 86,118,972 - 86,164,115 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 83,350,999 - 83,395,987 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 88,311,639 - 88,436,561 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 88,317,145 - 88,436,789 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 92,937,900 - 93,062,655 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 85,801,449 - 85,846,636 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 85,816,366 - 85,822,349 (-) NCBI Celera 13 81,860,445 - 81,905,616 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
DDR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 162,630,863 - 162,787,405 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 162,631,373 - 162,787,405 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 162,600,653 - 162,757,195 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 160,868,852 - 161,016,879 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 159,333,917 - 159,481,869 NCBI Celera 1 135,705,279 - 135,854,329 (+) NCBI Celera Cytogenetic Map 1 q23.3 NCBI HuRef 1 133,847,299 - 133,995,362 (+) NCBI HuRef CHM1_1 1 164,024,739 - 164,172,823 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 161,974,884 - 162,131,644 (+) NCBI T2T-CHM13v2.0
Ddr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 169,799,874 - 169,938,525 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 169,799,876 - 169,938,331 (-) Ensembl GRCm39 Ensembl GRCm38 1 169,972,307 - 170,110,836 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 169,972,307 - 170,110,762 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 171,902,438 - 172,019,075 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 171,814,321 - 171,947,234 (-) NCBI MGSCv36 mm8 Celera 1 172,414,199 - 172,531,584 (-) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 76.84 NCBI
Ddr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955462 13,584,724 - 13,642,968 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955462 13,578,638 - 13,644,834 (-) NCBI ChiLan1.0 ChiLan1.0
DDR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 86,997,783 - 87,151,567 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 86,666,323 - 86,818,185 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 138,048,730 - 138,200,426 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 141,845,361 - 141,997,082 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 141,932,158 - 141,990,766 (+) Ensembl panpan1.1 panPan2
DDR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 20,002,984 - 20,152,930 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 20,008,057 - 20,152,275 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 20,058,141 - 20,208,046 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 20,086,562 - 20,234,983 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 20,088,843 - 20,234,493 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 20,061,517 - 20,211,219 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 20,413,313 - 20,562,417 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 20,704,566 - 20,854,433 (-) NCBI UU_Cfam_GSD_1.0
Ddr2
DDR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 87,756,168 - 87,911,296 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 87,749,738 - 87,911,818 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 95,474,605 - 95,564,964 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DDR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 1,298,636 - 1,451,872 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 1,299,574 - 1,359,674 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 314,909 - 469,563 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ddr2
.
Predicted Target Of
Count of predictions: 386 Count of miRNA genes: 225 Interacting mature miRNAs: 268 Transcripts: ENSRNOT00000003901 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 4889606 Gluco63 Glucose level QTL 63 2.86 0.003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 80753256 106807694 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH130509
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,193,661 - 82,193,848 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,311,678 - 88,311,864 NCBI Rnor6.0 Rnor_5.0 13 92,937,939 - 92,938,125 UniSTS Rnor5.0 RGSC_v3.4 13 85,796,722 - 85,796,908 UniSTS RGSC3.4 Celera 13 81,855,718 - 81,855,904 UniSTS RH 3.4 Map 13 516.5 UniSTS Cytogenetic Map 13 q24 UniSTS
AW495251
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,199,287 - 82,199,410 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,317,304 - 88,317,426 NCBI Rnor6.0 Rnor_5.0 13 92,943,565 - 92,943,687 UniSTS Rnor5.0 RGSC_v3.4 13 85,802,348 - 85,802,470 UniSTS RGSC3.4 Celera 13 81,861,344 - 81,861,466 UniSTS Cytogenetic Map 13 q24 UniSTS
RH141613
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 82,199,040 - 82,199,241 (+) MAPPER mRatBN7.2 Rnor_6.0 13 88,317,057 - 88,317,257 NCBI Rnor6.0 Rnor_5.0 13 92,943,318 - 92,943,518 UniSTS Rnor5.0 RGSC_v3.4 13 85,802,101 - 85,802,301 UniSTS RGSC3.4 Celera 13 81,861,097 - 81,861,297 UniSTS RH 3.4 Map 13 516.6 UniSTS Cytogenetic Map 13 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003901 ⟹ ENSRNOP00000003901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 82,195,463 - 82,317,363 (-) Ensembl Rnor_6.0 Ensembl 13 88,317,145 - 88,436,789 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105822 ⟹ ENSRNOP00000092781
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 82,195,463 - 82,227,210 (-) Ensembl
RefSeq Acc Id:
NM_031764 ⟹ NP_113952
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,731,178 - 84,776,327 (-) NCBI mRatBN7.2 13 82,198,389 - 82,243,540 (-) NCBI Rnor_6.0 13 88,316,405 - 88,361,682 (-) NCBI Rnor_5.0 13 92,937,900 - 93,062,655 (-) NCBI RGSC_v3.4 13 85,801,449 - 85,846,636 (-) RGD Celera 13 81,860,445 - 81,905,616 (-) RGD
Sequence:
CTGAAATGATCCTGATTCCCAGAATGCCTCTGGTGCTGCTGCTGCTCCTGCTCATCCTGGGTTCTGCAAAAGCTCAGGTTAATCCAGCCATATGTCGCTATCCTCTGGGCATGTCAGGAGGCCACATT
hide sequence
RefSeq Acc Id:
XM_006250227 ⟹ XP_006250289
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,851,021 (-) NCBI mRatBN7.2 13 82,193,623 - 82,318,229 (-) NCBI Rnor_6.0 13 88,311,639 - 88,436,561 (-) NCBI Rnor_5.0 13 92,937,900 - 93,062,655 (-) NCBI
Sequence:
TTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTGTAGAGAAGGCAGTGAGGGGAAGAGATTAAAACACACTTTTTGGAGGAGGGCTCAGCTCTCATGGCCAAAATACGAAAGATCAGCTCCATGT
hide sequence
RefSeq Acc Id:
XM_006250228 ⟹ XP_006250290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,849,925 (-) NCBI mRatBN7.2 13 82,198,389 - 82,317,130 (-) NCBI Rnor_6.0 13 88,311,639 - 88,435,797 (-) NCBI Rnor_5.0 13 92,937,900 - 93,062,655 (-) NCBI
Sequence:
TCTTTTCTAAAAAAACGAAAGTTCTAAGTGTACTTCTCTTGGTGTGTCAGGAAAAGTTTTAAAAAGCGGCCGGAGGACAGTTTGAATCGGGGCGGAAGGGCAGGGAGCTGGGCTCTACAAGACTCAGG
hide sequence
RefSeq Acc Id:
XM_006250229 ⟹ XP_006250291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,851,021 (-) NCBI mRatBN7.2 13 82,198,389 - 82,318,229 (-) NCBI Rnor_6.0 13 88,311,639 - 88,436,561 (-) NCBI Rnor_5.0 13 92,937,900 - 93,062,655 (-) NCBI
Sequence:
TTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTGTAGAGAAGGCAGTGAGGGGAAGAGATTAAAACACACTTTTTGGAGGAGGGCTCAGCTCTCATGGCCAAAATACGAAAGATCAGCTCCATGT
hide sequence
RefSeq Acc Id:
XM_008769761 ⟹ XP_008767983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,851,032 (-) NCBI mRatBN7.2 13 82,198,389 - 82,318,229 (-) NCBI Rnor_6.0 13 88,311,639 - 88,436,561 (-) NCBI
Sequence:
TTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTGTAGAGAAGGCAGTGAGGGGAAGAGATTAAAACACACTTTTTGGAGGAGGGCTCAGCTCTCATGGCCAAAATACGAAAGATCAGCTCCATGT
hide sequence
RefSeq Acc Id:
XM_008769762 ⟹ XP_008767984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,849,732 (-) NCBI mRatBN7.2 13 82,198,389 - 82,316,850 (-) NCBI Rnor_6.0 13 88,311,639 - 88,435,552 (-) NCBI
Sequence:
TAAACAGTTTTAGCAGAGTTGGAAATGTTGGCAGGCAAGACAGGCCGATCGCAGAGTCAAGCTGCTGGAGAGAGGCAAGCCAGGAGCTGTGTTTTCAGGCTTTGAGTTGGTGGTGTTTGAGGGACCTG
hide sequence
RefSeq Acc Id:
XM_063272616 ⟹ XP_063128686
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,826,980 (-) NCBI
RefSeq Acc Id:
XM_063272617 ⟹ XP_063128687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 84,726,412 - 84,851,021 (-) NCBI
RefSeq Acc Id:
NP_113952 ⟸ NM_031764
- Peptide Label:
precursor
- UniProtKB:
A0A8I6AIV9 (UniProtKB/TrEMBL), A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL)
- Sequence:
MILIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGNR
hide sequence
RefSeq Acc Id:
XP_006250291 ⟸ XM_006250229
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIV9 (UniProtKB/TrEMBL), A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL)
- Sequence:
MILIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGNR
hide sequence
RefSeq Acc Id:
XP_006250289 ⟸ XM_006250227
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIV9 (UniProtKB/TrEMBL), A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL)
- Sequence:
MILIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGNR
hide sequence
RefSeq Acc Id:
XP_006250290 ⟸ XM_006250228
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIV9 (UniProtKB/TrEMBL), A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL)
- Sequence:
MILIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGNR
hide sequence
RefSeq Acc Id:
XP_008767983 ⟸ XM_008769761
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIV9 (UniProtKB/TrEMBL), A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL)
- Sequence:
MILIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGNR
hide sequence
RefSeq Acc Id:
XP_008767984 ⟸ XM_008769762
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIV9 (UniProtKB/TrEMBL), A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL)
- Sequence:
MILIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGNR
hide sequence
Ensembl Acc Id:
ENSRNOP00000003901 ⟸ ENSRNOT00000003901
Ensembl Acc Id:
ENSRNOP00000092781 ⟸ ENSRNOT00000105822
RefSeq Acc Id:
XP_063128687 ⟸ XM_063272617
- Peptide Label:
isoform X1
- UniProtKB:
A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL), A0A8I6AIV9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128686 ⟸ XM_063272616
- Peptide Label:
isoform X1
- UniProtKB:
A0A9K3Y730 (UniProtKB/TrEMBL), B1WC09 (UniProtKB/TrEMBL), F7EVN7 (UniProtKB/TrEMBL), A0A8I6AIV9 (UniProtKB/TrEMBL)
RGD ID: 13698982 Promoter ID: EPDNEW_R9507 Type: multiple initiation site Name: Ddr2_1 Description: discoidin domain receptor tyrosine kinase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 88,436,833 - 88,436,893 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-06-15
Ddr2
discoidin domain receptor tyrosine kinase 2
Ddr2_predicted
discoidin domain receptor family, member 2 (predicted)
Data merged from RGD:1304674
1643240 APPROVED
2008-09-25
Ddr2
discoidin domain receptor tyrosine kinase 2
Ddr2
discoidin domain receptor family, member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-14
Ddr2
discoidin domain receptor family, member 2
LOC685781
similar to Discoidin domain-containing receptor 2 precursor (Discoidin domain receptor 2) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO 10) (Neurotrophic tyrosine kinase, receptor-related 3) (CD167b antigen)
Data merged from RGD:1590187
737654 APPROVED
2006-11-20
LOC685781
similar to Discoidin domain-containing receptor 2 precursor (Discoidin domain receptor 2) (Receptor protein-tyrosine kinase TKT) (Tyrosine-protein kinase TYRO 10) (Neurotrophic tyrosine kinase, receptor-related 3) (CD167b antigen)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-20
Ddr2
discoidin domain receptor family, member 2
Symbol and Name status set to approved
1299863 APPROVED
2005-01-12
Ddr2_predicted
discoidin domain receptor family, member 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
2002-08-07
Ddr2
discoidin domain receptor family, member 2
Symbol and Name status set to provisional
70820 PROVISIONAL
