Advanced Search (OLGA)

Gene: Nrbf2 (nuclear receptor binding factor 2) Rattus norvegicus

Analyze

Symbol:

Nrbf2

Name:

nuclear receptor binding factor 2

RGD ID:

61937

Description:

Enables nuclear receptor binding activity. Involved in positive regulation of DNA-templated transcription. Predicted to be located in autophagosome; cytoplasmic vesicle; and nucleus. Predicted to be part of phosphatidylinositol 3-kinase complex, class III. Orthologous to human NRBF2 (nuclear receptor binding factor 2); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-di-tert-butyl-4-methylphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

NRBF-2; nuclear receptor-binding factor 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NRBF2 (nuclear receptor binding factor 2)	RGD	RGD
Mus musculus (house mouse):	Nrbf2 (nuclear receptor binding factor 2)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Nrbf2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NRBF2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NRBF2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nrbf2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NRBF2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NRBF2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nrbf2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nrbf2 (nuclear receptor binding factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DDX41 (DEAD-box helicase 41)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Nrbf2 (nuclear receptor binding factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NRBF2 (nuclear receptor binding factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NRBF2 (nuclear receptor binding factor 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nrbf2b (nuclear receptor binding factor 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nrbf2a (nuclear receptor binding factor 2a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG42554	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG42554	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nrbf2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nrbf2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	21,307,389 - 21,325,724 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	21,290,787 - 21,325,724 (+)	Ensembl				GRCr8
mRatBN7.2	20	21,308,555 - 21,326,881 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	21,308,576 - 21,326,818 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	22,032,725 - 22,051,050 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	21,385,794 - 21,404,118 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	21,862,932 - 21,881,258 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	22,728,145 - 22,746,477 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	22,728,208 - 22,746,474 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	24,818,944 - 24,837,210 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	22,128,235 - 22,146,505 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	22,666,821 - 22,685,091 (+)	NCBI		Celera
RGSC_v3.1	20	22,142,034 - 22,160,305 (+)	NCBI
Cytogenetic Map	20	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-di-tert-butyl-4-methylphenol (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

bromobenzene (EXP)

butanal (ISO)

caffeine (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

cyclosporin A (ISO)

cyproterone acetate (ISO)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

folic acid (ISO)

FR900359 (ISO)

genistein (EXP)

gentamycin (EXP)

glafenine (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

nitrates (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP,ISO)

phorone (EXP)

pirinixic acid (ISO)

profenofos (EXP)

propiconazole (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagy (IBA,IEA,ISO)

DNA-templated transcription (IEA)

positive regulation of DNA-templated transcription (IDA)

regulation of lipid kinase activity (ISO)

response to endoplasmic reticulum stress (ISO)

Cellular Component

autophagosome (IEA)

cytoplasm (IEA,ISO)

cytoplasmic vesicle (IEA)

nucleus (IEA)

phosphatidylinositol 3-kinase complex, class III (ISO)

Molecular Function

nuclear receptor binding (IDA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
6.	Nuclear receptor binding factor-2 (NRBF-2), a possible gene activator protein interacting with nuclear hormone receptors.	Yasumo H, etal., Biochim Biophys Acta 2000 Jan 31;1490(1-2):189-97.

Additional References at PubMed

PMID:24785657	PMID:24849286	PMID:30053369

Genomics

Comparative Map Data

Nrbf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	21,307,389 - 21,325,724 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	21,290,787 - 21,325,724 (+)	Ensembl				GRCr8
mRatBN7.2	20	21,308,555 - 21,326,881 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	21,308,576 - 21,326,818 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	22,032,725 - 22,051,050 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	21,385,794 - 21,404,118 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	21,862,932 - 21,881,258 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	22,728,145 - 22,746,477 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	22,728,208 - 22,746,474 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	24,818,944 - 24,837,210 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	22,128,235 - 22,146,505 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	22,666,821 - 22,685,091 (+)	NCBI		Celera
RGSC_v3.1	20	22,142,034 - 22,160,305 (+)	NCBI
Cytogenetic Map	20	p11	NCBI

NRBF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	63,133,328 - 63,155,024 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	63,133,247 - 63,155,031 (+)	Ensembl			hg38	GRCh38
GRCh37	10	64,893,088 - 64,914,784 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	64,563,013 - 64,584,792 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	64,563,058 - 64,584,789	NCBI
Celera	10	58,160,328 - 58,182,105 (+)	NCBI		Celera
Cytogenetic Map	10	q21.3	NCBI
HuRef	10	58,884,726 - 58,906,509 (+)	NCBI		HuRef
CHM1_1	10	65,175,078 - 65,196,846 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	63,991,431 - 64,013,145 (+)	NCBI		T2T-CHM13v2.0

Nrbf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	67,102,463 - 67,121,076 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	67,102,468 - 67,121,084 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	67,266,689 - 67,285,343 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	67,266,689 - 67,285,305 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	66,729,437 - 66,748,029 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	66,662,046 - 66,680,638 (-)	NCBI		MGSCv36	mm8
Celera	10	68,358,949 - 68,377,541 (-)	NCBI		Celera
Cytogenetic Map	10	B5.1	NCBI
cM Map	10	34.89	NCBI

Nrbf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	16,330,114 - 16,340,621 (+)	Ensembl
ChiLan1.0	NW_004955425	16,330,115 - 16,336,798 (+)	NCBI	ChiLan1.0	ChiLan1.0

NRBF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	75,318,097 - 75,340,092 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	75,323,454 - 75,345,415 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	59,640,101 - 59,662,071 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	61,965,758 - 61,987,435 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	61,965,758 - 61,987,435 (+)	Ensembl			panPan2	panpan1.1

NRBF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	14,958,142 - 14,991,146 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	14,958,226 - 14,990,325 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	15,175,404 - 15,208,380 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	15,222,273 - 15,255,413 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	15,222,273 - 15,255,423 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	15,204,403 - 15,237,395 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	15,329,570 - 15,362,525 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	15,685,188 - 15,718,168 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nrbf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	66,078,785 - 66,097,366 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936753	1,653,394 - 1,671,996 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936753	1,653,394 - 1,671,996 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NRBF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	66,590,372 - 66,631,363 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	66,590,307 - 66,629,573 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	71,827,128 - 71,866,397 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NRBF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	68,150,245 - 68,173,388 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	68,151,057 - 68,159,455 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	29,035,221 - 29,057,172 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nrbf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	602,274 - 620,327 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624791	602,774 - 620,186 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nrbf2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	19,543,384 - 19,560,913 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nrbf2
80 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	110
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000000794
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8043920	29865039	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	20745585	56021148	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1598870	Bp289	Blood pressure QTL 289	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	8216359	53216359	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
1598858	Cm61	Cardiac mass QTL 61	3.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	20	8216359	53216359	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	12243242	49189476	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	163	91	90	59	92	59	6	355	191	10	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB024930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000794 ⟹ ENSRNOP00000000794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	21,307,400 - 21,325,724 (+)	Ensembl
mRatBN7.2 Ensembl	20	21,308,576 - 21,326,818 (+)	Ensembl
Rnor_6.0 Ensembl	20	22,728,208 - 22,746,474 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130748 ⟹ ENSRNOP00000109901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	21,290,787 - 21,325,724 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000166716 ⟹ ENSRNOP00000111486

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	21,307,400 - 21,322,333 (+)	Ensembl

RefSeq Acc Id:

NM_022186 ⟹ NP_071522

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	21,307,400 - 21,325,724 (+)	NCBI
mRatBN7.2	20	21,308,555 - 21,326,881 (+)	NCBI
Rnor_6.0	20	22,728,208 - 22,746,474 (+)	NCBI
Rnor_5.0	20	24,818,944 - 24,837,210 (+)	NCBI
RGSC_v3.4	20	22,128,235 - 22,146,505 (+)	RGD
Celera	20	22,666,821 - 22,685,091 (+)	RGD

Sequence:

show sequence

CCGGCTCCGGGTTCTGCTTGGAGCCTCCTGCCAGCCGCCGCGTCTCCCTGCCCTCGCTGCCCCT
CCATGTGCCCAGGTGCCGCCGCTCCGCCTCGGGCCGCCGCTCACCCCGGGGTCTATGGAAGTGA
TGGAAGGACCCCTCAACCTTGCTCACCAACAGAGCCGACGGGCAGACCGTTTGTTAGCTGCTGG
GAAATACGAAGAAGCGATTTCTTGTCACAAAAAGGCGACAGCCTATCTCTCTGAAGCCATGAAG
CTGACACAGTCTGAACAGGCTCACTTATCACTGGAACTGCAAAGGGATAGCCACATGAAGCAGC
TTCTCCTCATCCAGGAGAGGTGGAAGAGAGCGAAGCGAGAGGAGCGGTTGAAAGCGCAGCAGAG
CACAGACCGGGATGGAGTCCCCCACCTGCAGGCATCTCACAGACCCTCTGAGGACTCGGAAGGC
CAGAGCCCTCTTCTTTCTCAGACATACATCCCTTCCACAGAGAAGCGCCTCCCTGAGGAGCAGG
GGGTCTTTGACAGGGATCCAGACACGTTGCTATTTTTACTTCAGCAAAAGAATGAGCCGTCAGA
GCCCTGTATTGGAAGCAAGGCCCCAAAAGATGATAAGACGATTATAGAGGAGCAGGCAACCAAG
ATTGCAGAGTTGAAGAGGCACGTGGAGTTCCTTGTGGCGGAGAACGAAAGACTAAGGAAAGAAA
ATAAACAGCTAAAGGCTGAAAAGGCCAGGCTCCTGAAGGGCCCAGCCGAGAAGGAGCTGGATGT
CGATGCGGACTTTGTGGAGAAGTCGGAGCTGTGGGGCTTGCCGCCACACTCGGACACCGCCACT
GCCTCTTCTACCTGGCAGAAGTTTGCAGCTAACACGGGGAAAGCCAAGGACATTCCAATACCCA
ACCTCCCGCCTCTGGATTTCCCGTCTCCAGAACTCCCTCTGATGGAGCTCTCGGAGGACATTCT
GAAAGGATTCATGAATGACTGAATGGAAGGCTGGCCACACAGCTGATCCAGCAGAGAATACAAA
GGGAAAGCCAGGCCCCGGGGGAGGCCAGCCATGCTGGAGATGCTCCTTCCTCTGGAGTGCTGTG
GGAGAGGTGGCGGTGCCAGGACCTGGGAAAGTCACTGTGAAACATCACTTATCTTCTTCACGAC
TAAAGCTCATGATTCCGACTTGGCAGACACTGAACTCTTGGAGGTCGCTTTCTTATGATACAAA
CCAAATGGCTACCTGGAATAATTTTTCAAACACTTATTTTTCTTATCTTCAGGGTTAAATGTAT
AAAAGTATGTCATGTGTAATTAATCTATAATGCCATAAATGATAATGCAAAAGCTAACTATGGT
GGCCTGAGAGGCTCACTTGTATTTGGAACATGCTTTCTATCATGCGTTGACTGTATGCATTTCA
TGCACATTTTGTTTGTTTGAGATATGGTGTGTAAGATACACGCTTCCAGACGGAACTGTACGTG
CCACAGTTTGCACTACTCGTAACATAATGATAACCTCAAGACTATCAGGAGAAATATTTAAATT
TCCAGTTTATGAAGAAAGGAACCAAATTATTAGTTACGCTTTTAAAAAAAATTACCAGTTTACA
TAATTAATCAGGGTGCATTTTCAGTTCTAACTTTGTGTTATATATGCATCATTTGAAAATACTG
AGGAACNCTTCCTCTCGTTCTGAATGATGCATGTGTGAAAGTAATGCTAGTTAGCAGTATTTGA
TTGTAAGAAATCAATAAAATAATTGTGTTTC

hide sequence

RefSeq Acc Id:

XM_063279484 ⟹ XP_063135554

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	21,311,535 - 21,325,724 (+)	NCBI

RefSeq Acc Id:

XM_063279485 ⟹ XP_063135555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	21,307,389 - 21,325,724 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071522	(Get FASTA)	NCBI Sequence Viewer
	XP_063135554	(Get FASTA)	NCBI Sequence Viewer
	XP_063135555	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA88955	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000794
GenBank Protein	Q9QYK3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071522 ⟸ NM_022186

- UniProtKB:

Q9QYK3 (UniProtKB/Swiss-Prot), G3V622 (UniProtKB/TrEMBL), A6JKW4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKATAYLSEAMKLTQSEQAHLSLELQRDSH
MKQLLLIQERWKRAKREERLKAQQSTDRDGVPHLQASHRPSEDSEGQSPLLSQTYIPSTEKRLP
EEQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIAELKRHVEFLVAENERL
RKENKQLKAEKARLLKGPAEKELDVDADFVEKSELWGLPPHSDTATASSTWQKFAANTGKAKDI
PIPNLPPLDFPSPELPLMELSEDILKGFMND

hide sequence

Ensembl Acc Id:

ENSRNOP00000000794 ⟸ ENSRNOT00000000794

RefSeq Acc Id:	XP_063135555 ⟸ XM_063279485
- Peptide Label:	isoform X2
- UniProtKB:	Q9QYK3 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063135554 ⟸ XM_063279484
- Peptide Label:	isoform X1
- UniProtKB:	Q9QYK3 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000111486 ⟸ ENSRNOT00000166716

Ensembl Acc Id:

ENSRNOP00000109901 ⟸ ENSRNOT00000130748

Protein Domains

Nuclear receptor-binding factor 2 C-terminal Nuclear receptor-binding factor 2 MIT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QYK3-F1-model_v2	AlphaFold	Q9QYK3	1-287	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701563

Promoter ID:

EPDNEW_R12086

Type:

initiation region

Name:

Nrbf2_1

Description:

nuclear receptor binding factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	22,728,204 - 22,728,264	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61937	AgrOrtholog
BioCyc Gene	G2FUF-3865	BioCyc
Ensembl Genes	ENSRNOG00000000641	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000000794	ENTREZGENE
Gene3D-CATH	Phosphotransferase system, lactose/cellobiose-type IIA subunit	UniProtKB/Swiss-Prot
InterPro	NRBF2	UniProtKB/Swiss-Prot
	NRBF2_C	UniProtKB/Swiss-Prot
	NRBF2_MIT	UniProtKB/Swiss-Prot
KEGG Report	rno:58839	UniProtKB/Swiss-Prot
NCBI Gene	58839	ENTREZGENE
PANTHER	NUCLEAR RECEPTOR-BINDING FACTOR 2	UniProtKB/Swiss-Prot
	PTHR14964	UniProtKB/Swiss-Prot
Pfam	NRBF2	UniProtKB/Swiss-Prot
	NRBF2_MIT	UniProtKB/Swiss-Prot
PhenoGen	Nrbf2	PhenoGen
RatGTEx	ENSRNOG00000000641	RatGTEx
Superfamily-SCOP	MIT domain-like	UniProtKB/Swiss-Prot
TIGR	TC208752
UniProt	A0ABK0LUJ5_RAT	UniProtKB/TrEMBL
	A0ABK0M7K6_RAT	UniProtKB/TrEMBL
	A6JKW4	ENTREZGENE, UniProtKB/TrEMBL
	G3V622	ENTREZGENE, UniProtKB/TrEMBL
	NRBF2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Nrbf2	nuclear receptor binding factor 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message