Advanced Search (OLGA)

Gene: Tub (TUB bipartite transcription factor) Rattus norvegicus

Analyze

Symbol:

Tub

Name:

TUB bipartite transcription factor

RGD ID:

3918

Description:

Predicted to enable G protein-coupled receptor binding activity and intraciliary transport particle A binding activity. Involved in response to cocaine and response to hormone. Located in nucleus and plasma membrane. Orthologous to human TUB (TUB bipartite transcription factor); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Tubby (mouse) homolog; tubby bipartite transcription factor; tubby homolog (mouse); tubby protein homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TUB (TUB bipartite transcription factor)	RGD	RGD
Mus musculus (house mouse):	Tub (TUB bipartite transcription factor)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Tub (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TUB (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TUB (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tub (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TUB (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TUB (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tub (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tub (TUB bipartite transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Tub (TUB bipartite transcription factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TUB (TUB bipartite transcription factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tub (tubby bipartite transcription factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tub-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tub-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ktub	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ktub	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tub	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tub	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	172,386,772 - 172,465,791 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	172,382,197 - 172,465,790 (+)	Ensembl				GRCr8
mRatBN7.2	1	163,008,198 - 163,030,958 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	162,951,931 - 163,026,812 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	171,350,257 - 171,368,453 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	178,536,314 - 178,554,516 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	171,209,520 - 171,227,526 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	173,550,929 - 173,629,550 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	173,607,101 - 173,625,550 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	180,541,359 - 180,618,745 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	1	160,923,600 - 160,933,169 (+)	NCBI		Celera
RH 3.4 Map	1	1355.4	RGD
Cytogenetic Map	1	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

fundus dystrophy (ISO)

obesity (ISO,ISS)

Retinal Dystrophy and Obesity (ISO)

retinitis pigmentosa 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

2-palmitoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

ethanol (ISO)

FR900359 (ISO)

gentamycin (EXP)

lead(0) (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

methoxychlor (EXP)

microcystin-LR (EXP)

nickel atom (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

testosterone (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intraciliary transport (ISO)

phagocytosis (IEA)

phagocytosis, recognition (ISO)

photoreceptor cell maintenance (ISO)

positive regulation of phagocytosis (ISO,ISS)

protein localization to cilium (IBA,ISO)

protein localization to photoreceptor outer segment (ISO)

receptor localization to non-motile cilium (ISO)

regulation of G protein-coupled receptor signaling pathway (ISO)

response to cocaine (IEP)

response to hormone (IEP)

retina development in camera-type eye (ISO)

sensory perception of sound (ISO)

Cellular Component

cilium (IBA,ISO)

cytoplasm (IEA,ISO)

cytosol (ISO)

extracellular region (IEA,ISO)

nucleus (IDA,IEA,ISO)

plasma membrane (IDA,IEA)

Molecular Function

G protein-coupled receptor binding (ISO)

intraciliary transport particle A binding (ISO)

protein binding (ISO)

protein-containing complex binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Catabolic action of insulin in rat arcuate nucleus is not enhanced by exogenous "tub" expression.	Figlewicz DP, etal., Am J Physiol Endocrinol Metab 2004 Jun;286(6):E1004-10. Epub 2004 Jan 28.
2.	Cocaine potentiates multiple 5-HT2A receptor signaling pathways and is associated with decreased phosphorylation of 5-HT2A receptors in vivo.	Franklin JM and Carrasco GA, J Mol Neurosci. 2015 Mar;55(3):770-7. doi: 10.1007/s12031-014-0419-z. Epub 2014 Sep 12.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Identification and characterization of the mouse obesity gene tubby: a member of a novel gene family.	Kleyn PW, etal., Cell. 1996 Apr 19;85(2):281-90.
5.	Thyroid hormone regulates the obesity gene tub.	Koritschoner NP, etal., EMBO Rep 2001 Jun;2(6):499-504.
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Absence of linkage of obesity and energy metabolism to markers flanking homologues of rodent obesity genes in Pima Indians.	Norman RA, etal., Diabetes. 1996 Sep;45(9):1229-32.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Targeting of vasoactive intestinal peptide receptor 2, VPAC2, a secretin family G-protein coupled receptor, to primary cilia.	Soetedjo L, etal., Biol Open. 2013 May 23;2(7):686-94. doi: 10.1242/bio.20134747. Print 2013 Jul 15.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:10629044	PMID:11925566	PMID:19695251	PMID:19837063	PMID:19887065	PMID:20889716	PMID:20978472	PMID:21052544	PMID:23351594	PMID:24316073	PMID:25931508	PMID:28154160

Genomics

Comparative Map Data

Tub
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	172,386,772 - 172,465,791 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	172,382,197 - 172,465,790 (+)	Ensembl				GRCr8
mRatBN7.2	1	163,008,198 - 163,030,958 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	162,951,931 - 163,026,812 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	171,350,257 - 171,368,453 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	178,536,314 - 178,554,516 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	171,209,520 - 171,227,526 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	173,550,929 - 173,629,550 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	173,607,101 - 173,625,550 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	180,541,359 - 180,618,745 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	1	160,923,600 - 160,933,169 (+)	NCBI		Celera
RH 3.4 Map	1	1355.4	RGD
Cytogenetic Map	1	q33	NCBI

TUB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	8,019,245 - 8,106,243 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	8,019,244 - 8,106,243 (+)	Ensembl			hg38	GRCh38
GRCh37	11	8,060,180 - 8,127,790 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	8,016,756 - 8,084,228 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	8,059,484 - 8,084,228	NCBI
Celera	11	8,175,909 - 8,243,289 (+)	NCBI		Celera
Cytogenetic Map	11	p15.4	NCBI
HuRef	11	7,726,921 - 7,794,103 (+)	NCBI		HuRef
CHM1_1	11	8,059,163 - 8,126,615 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	8,098,417 - 8,185,410 (+)	NCBI		T2T-CHM13v2.0

Tub
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	108,610,087 - 108,633,666 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	108,549,545 - 108,633,667 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	109,010,880 - 109,034,459 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	108,950,338 - 109,034,460 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	116,154,394 - 116,177,973 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	108,802,057 - 108,825,636 (+)	NCBI		MGSCv36	mm8
Celera	7	108,987,319 - 109,010,903 (+)	NCBI		Celera
Cytogenetic Map	7	E3	NCBI
cM Map	7	57.21	NCBI

Tub
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	23,898,345 - 23,917,952 (+)	Ensembl
ChiLan1.0	NW_004955414	23,832,741 - 23,919,697 (+)	NCBI	ChiLan1.0	ChiLan1.0

TUB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	10,442,367 - 10,529,803 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	10,404,530 - 10,491,857 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	8,135,981 - 8,223,414 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	7,882,680 - 7,969,434 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	7,882,680 - 7,969,434 (+)	Ensembl			panPan2	panpan1.1

TUB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	31,566,095 - 31,629,545 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	31,566,130 - 31,625,101 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	31,169,705 - 31,198,274 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	32,474,471 - 32,503,096 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	32,418,336 - 32,502,574 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	31,744,431 - 31,773,004 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	31,854,131 - 31,938,931 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	32,204,165 - 32,232,719 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tub
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	53,796,392 - 53,860,166 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936528	9,834,954 - 9,855,080 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936528	9,829,889 - 9,912,645 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TUB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	1,183,822 - 1,206,274 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	1,183,821 - 1,260,209 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	1,493,594 - 1,516,072 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TUB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	56,699,044 - 56,764,162 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	56,699,408 - 56,783,126 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	154,416,365 - 154,510,473 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tub
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	268,778 - 293,356 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624766	206,082 - 293,922 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tub
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	92,452,223 - 92,530,707 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tub
270 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	83
Count of miRNA genes:	79
Interacting mature miRNAs:	83
Transcripts:	ENSRNOT00000074636
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	153679879	198679879	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	153679879	205813246	Rat
8694166	Bw147	Body weight QTL 147	6.83	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	1	153788989	198788989	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	160573753	210707719	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	160573753	210707719	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	165278545	210278545	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	161077990	206077990	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	168063662	213063662	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	159894717	207261263	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	163992710	208992710	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	155359438	194575574	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	162753891	207753891	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	153680016	182383862	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	153680016	183564652	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1582204	Livw1	Liver weight QTL 1	3.6	0.0003	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	1	170078537	182384005	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	210707719	Rat
8693608	Alc24	Alcohol consumption QTL 24	2.3	0.74	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	159863716	177663210	Rat
1576310	Schws2	Schwannoma susceptibility QTL 2		0.029	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	1	153788989	198788989	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	165707719	210707719	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
7411599	Foco11	Food consumption QTL 11	18.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	1	153788989	198788989	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	210707719	Rat

Markers in Region

D1Wox39

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	1	q	UniSTS

tub

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	163,025,770 - 163,025,861 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	173,624,368 - 173,624,458	NCBI	Rnor6.0
Rnor_5.0	1	180,614,827 - 180,614,917	UniSTS	Rnor5.0
Celera	1	160,932,128 - 160,932,218	UniSTS
Cytogenetic Map	1	q	UniSTS

RH94759

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	163,026,118 - 163,026,775 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	173,624,716 - 173,625,372	NCBI	Rnor6.0
Rnor_5.0	1	180,615,175 - 180,615,831	UniSTS	Rnor5.0
Celera	1	160,932,476 - 160,933,132	UniSTS
RH 3.4 Map	1	1355.4	UniSTS
Cytogenetic Map	1	q	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	10	66	159	73	72	41	83	41	6	298	180	9	138	56	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB011544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC107497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U92546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074636 ⟹ ENSRNOP00000064486

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,443,342 - 172,461,645 (+)	Ensembl
mRatBN7.2 Ensembl	1	163,008,510 - 163,026,812 (+)	Ensembl
Rnor_6.0 Ensembl	1	173,607,101 - 173,625,550 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096784 ⟹ ENSRNOP00000083866

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	162,952,194 - 163,026,812 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107491 ⟹ ENSRNOP00000097726

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,386,724 - 172,465,790 (+)	Ensembl
mRatBN7.2 Ensembl	1	162,951,931 - 163,026,812 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000122264 ⟹ ENSRNOP00000104333

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,387,188 - 172,465,790 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130742 ⟹ ENSRNOP00000101142

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,382,197 - 172,465,790 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000139306 ⟹ ENSRNOP00000111371

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,430,102 - 172,465,790 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000145222 ⟹ ENSRNOP00000109367

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,387,068 - 172,465,790 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000154031 ⟹ ENSRNOP00000102379

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	172,387,068 - 172,465,790 (+)	Ensembl

RefSeq Acc Id:

NM_013077 ⟹ NP_037209

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	172,443,342 - 172,461,645 (+)	NCBI
mRatBN7.2	1	163,008,510 - 163,026,812 (+)	NCBI
Rnor_6.0	1	173,607,119 - 173,625,409 (+)	NCBI
Rnor_5.0	1	180,541,359 - 180,618,745 (+)	NCBI
Celera	1	160,923,600 - 160,933,169 (+)	RGD

Sequence:

show sequence

CATGACTTCCAAGCCGCATTCCGACTGGATTCCCTACAGTGTCCTAGATGATGAGGGCAGCAAC
CTGAGGCAGCAGAAGCTCGACCGGCAGCGGGCCCTGTTGGAGCAGAAGCAGAAGAAGAAGCGCC
AAGAGCCGCTGATGGTACAGGCCAATGCAGATGGGCGGCCTCGGAGCCGGCGTGCCAGGCAGTC
AGAGGAGCAAGCCCCCCTGGTCGAGTCCTACCTCAGCAGCAGCGGCAGCACCAGCTACCAAGTT
CAGGAGGCCGACTCACTTGCCAGTGTACAGCCGGGAGCCACCCGCCCACCAGCACCAGCCTCAG
CCAAGAAGACCAAGGGAGCAGCTGCATCCGGGGGCCAGGGTGGGGCCCCCAGGAAGGAGAAGAA
GGGGAAGCATAAAGGCACCAGCGGGCCAGCAACTCTGGCAGAAGACAAGTCTGAGGCCCAAGGC
CCAGTGCAGATCTTGACTGTGGGACAGTCAGACCACGCCAAGGATGCAGGGGAGACAGCAGCCG
GCGGGGGCGCACAGCCCAGCGGGCAGGACCTCCGAGCCACGATGCAGAGGAAGGGCATCTCCAG
CAGCATGAGCTTTGATGAGGAAGAGGATGAGGATGAAAACAGCTCTAGCTCCTCCCAGCTGAAC
AGCAACACCCGCCCTAGTTCTGCCACGAGCAGGAAGTCCACCAGGGAGGCAGCATCAGCCCCCA
GCCCAGCAGCCCCAGAGCCACCAGTGGATATTGAGGTCCAGGATCTAGAGGAGTTTGCCCTGAG
GCCAGCTCCACAAGGGATCACCATCAAATGCCGAATCACTCGGGACAAGAAGGGCATGGACCGG
GGCATGTACCCCACCTACTTTCTGCACCTAGACCGTGAAGATGGCAAGAAGGTGTTCCTCTTGG
CGGGCAGGAAGAGAAAGAAGAGTAAAACTTCCAATTACCTCATCTCTGTGGACCCGACAGACTT
GTCTCGGGGAGGCGATAGCTATATCGGGAAATTGCGGTCCAACCTGATGGGCACTAAGTTCACC
GTTTATGACAATGGCGTCAACCCTCAGAAGGCATCATCTTCTACACTGGAAAGTGGAACCCTGC
GCCAGGAGCTGGCAGCCGTGTGCTATGAGACAAATGTCCTAGGCTTCAAGGGACCCCGGAAGAT
GAGTGTGATCGTCCCAGGCATGAACATGGTTCATGAGAGAGTCTGTATCCGGCCCCGAAATGAA
CACGAGACGCTGTTAGCACGCTGGCAGAACAAGAACACGGAGAGCATCATTGAGCTGCAGAATA
AGACGCCAGTCTGGAATGATGACACGCAGTCCTATGTTCTTAATTTCCATGGGCGCGTCACACA
GGCTTCCGTGAAGAACTTCCAGATCATCCACGGCAATGACCCGGACTACATCGTCATGCAGTTT
GGCCGGGTAGCAGAAGATGTGTTCACCATGGATTACAACTACCCGCTGTGTGCACTGCAGGCCT
TTGCCATCGCTCTGTCCAGCTTTGACAGCAAGCTGGCCTGCGAGTAGAGGCTTCCACTGCCTTT
AGGGCGGCCCCGTCTGGAGTGGAGCCTGCCTGCACCTGCCCGGGCG

hide sequence

RefSeq Acc Id:

XM_063282067 ⟹ XP_063138137

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	172,386,772 - 172,465,791 (+)	NCBI

RefSeq Acc Id:

XM_063282071 ⟹ XP_063138141

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	172,387,158 - 172,465,791 (+)	NCBI

RefSeq Acc Id:

XM_063282072 ⟹ XP_063138142

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	172,439,974 - 172,465,791 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037209	(Get FASTA)	NCBI Sequence Viewer
	XP_063138137	(Get FASTA)	NCBI Sequence Viewer
	XP_063138141	(Get FASTA)	NCBI Sequence Viewer
	XP_063138142	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD09251	(Get FASTA)	NCBI Sequence Viewer
	BAA32734	(Get FASTA)	NCBI Sequence Viewer
	EDM17925	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064486
	ENSRNOP00000064486.1
	ENSRNOP00000097726
	ENSRNOP00000101142
	ENSRNOP00000104333
GenBank Protein	O88808	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037209 ⟸ NM_013077

- UniProtKB:

Q9Z1A2 (UniProtKB/Swiss-Prot), O88808 (UniProtKB/Swiss-Prot), A6I7V5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTSKPHSDWIPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQS
EEQAPLVESYLSSSGSTSYQVQEADSLASVQPGATRPPAPASAKKTKGAAASGGQGGAPRKEKK
GKHKGTSGPATLAEDKSEAQGPVQILTVGQSDHAKDAGETAAGGGAQPSGQDLRATMQRKGISS
SMSFDEEEDEDENSSSSSQLNSNTRPSSATSRKSTREAASAPSPAAPEPPVDIEVQDLEEFALR
PAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDL
SRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKM
SVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQ
ASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE

hide sequence

Ensembl Acc Id:

ENSRNOP00000064486 ⟸ ENSRNOT00000074636

Ensembl Acc Id:

ENSRNOP00000097726 ⟸ ENSRNOT00000107491

Ensembl Acc Id:

ENSRNOP00000083866 ⟸ ENSRNOT00000096784

RefSeq Acc Id:	XP_063138137 ⟸ XM_063282067
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZXW6 (UniProtKB/TrEMBL), A0A8I6GM69 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138141 ⟸ XM_063282071
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZXW6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138142 ⟸ XM_063282072
- Peptide Label:	isoform X3
- UniProtKB:	A6I7V5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000101142 ⟸ ENSRNOT00000130742

Ensembl Acc Id:

ENSRNOP00000102379 ⟸ ENSRNOT00000154031

Ensembl Acc Id:

ENSRNOP00000104333 ⟸ ENSRNOT00000122264

Ensembl Acc Id:

ENSRNOP00000111371 ⟸ ENSRNOT00000139306

Ensembl Acc Id:

ENSRNOP00000109367 ⟸ ENSRNOT00000145222

Protein Domains

Tubby C-terminal Tubby N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88808-F1-model_v2	AlphaFold	O88808	1-505	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3918	AgrOrtholog
BioCyc Gene	G2FUF-57881	BioCyc
Ensembl Genes	ENSRNOG00000046566	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074636	ENTREZGENE
	ENSRNOT00000074636.3	UniProtKB/Swiss-Prot
	ENSRNOT00000107491	ENTREZGENE
	ENSRNOT00000122264	ENTREZGENE
	ENSRNOT00000130742	ENTREZGENE
Gene3D-CATH	Tubby Protein, Chain A	UniProtKB/Swiss-Prot
InterPro	Tubby-like_C	UniProtKB/Swiss-Prot
	Tubby_C	UniProtKB/Swiss-Prot
	Tubby_C_CS	UniProtKB/Swiss-Prot
	Tubby_N	UniProtKB/Swiss-Prot
KEGG Report	rno:25609	UniProtKB/Swiss-Prot
NCBI Gene	25609	ENTREZGENE
PANTHER	TUBBY PROTEIN HOMOLOG	UniProtKB/Swiss-Prot
	TUBBY-RELATED	UniProtKB/Swiss-Prot
Pfam	Tub	UniProtKB/Swiss-Prot
	Tub_N	UniProtKB/Swiss-Prot
PhenoGen	Tub	PhenoGen
PRINTS	SUPERTUBBY	UniProtKB/Swiss-Prot
	TUBBYPROTEIN	UniProtKB/Swiss-Prot
PROSITE	TUB_1	UniProtKB/Swiss-Prot
	TUB_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000046566	RatGTEx
Superfamily-SCOP	SSF54518	UniProtKB/Swiss-Prot
TIGR	TC202677
UniProt	A0A8I5ZXW6	ENTREZGENE
	A0A8I6GM69	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LCZ2_RAT	UniProtKB/TrEMBL
	A0ABK0LL98_RAT	UniProtKB/TrEMBL
	A0ABK0LMW3_RAT	UniProtKB/TrEMBL
	A0ABK0LTD9_RAT	UniProtKB/TrEMBL
	A0ABK0LY26_RAT	UniProtKB/TrEMBL
	A6I7V5	ENTREZGENE, UniProtKB/TrEMBL
	O88808	ENTREZGENE
	Q9Z1A2	ENTREZGENE
	TUB_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9Z1A2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-05	Tub	TUB bipartite transcription factor	Tub	tubby bipartite transcription factor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-09-17	Tub	tubby bipartite transcription factor	Tub	tubby homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Tub	tubby homolog (mouse)		Tubby (mouse) homolog	Name updated	629478	APPROVED
2002-06-10	Tub	Tubby (mouse) homolog			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM