Symbol:
Slc30a2
Name:
solute carrier family 30 member 2
RGD ID:
3707
Description:
Enables zinc ion transmembrane transporter activity. Involved in intracellular zinc ion homeostasis and zinc ion import into zymogen granule. Predicted to be located in cytoplasmic vesicle; lysosomal membrane; and mitochondrial inner membrane. Predicted to be active in plasma membrane. Orthologous to human SLC30A2 (solute carrier family 30 member 2); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; all-trans-retinol.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
proton-coupled zinc antiporter SLC30A2; Solute carrier family 30 (zinc transporter) member 2; solute carrier family 30 (zinc transporter), member 2; solute carrier family 30, member 2; zinc transporter 2; Zink transporter 2; ZnT-2; Znt2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 151,843,451 - 151,855,674 (+) NCBI GRCr8 mRatBN7.2 5 146,559,733 - 146,571,957 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 146,559,733 - 146,571,956 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 149,261,093 - 149,273,806 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 151,031,874 - 151,044,095 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 151,017,317 - 151,030,034 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 152,559,577 - 152,571,800 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 152,559,577 - 152,571,799 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 156,356,502 - 156,368,725 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 153,086,346 - 153,098,569 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 153,097,114 - 153,107,129 (+) NCBI Celera 5 144,977,168 - 144,989,389 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Cellular Component
cytoplasm (IEA,ISO) cytoplasmic vesicle (IEA) endosome (IEA) endosome membrane (IEA,ISO,ISS,TAS) intracellular membrane-bounded organelle (IEA,ISO) late endosome (IEA,ISO) lysosomal membrane (IEA,ISO,ISS) lysosome (IEA) membrane (IEA) mitochondrial inner membrane (IEA,ISO,ISS) mitochondrion (IEA) plasma membrane (IBA,ISO) secretory vesicle (ISO,ISS) transport vesicle membrane (IEA) zymogen granule membrane (IEA,ISO,ISS)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
STAT5-glucocorticoid receptor interaction and MTF-1 regulate the expression of ZnT2 (Slc30a2) in pancreatic acinar cells.
Guo L, etal., Proc Natl Acad Sci U S A. 2010 Feb 16;107(7):2818-23. doi: 10.1073/pnas.0914941107. Epub 2010 Jan 27.
3.
High-level expression of zinc transporter-2 in the rat lateral and dorsal prostate.
Iguchi K, etal., J Androl 2002 Nov-Dec;23(6):819-24.
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
ZnT-2, a mammalian protein that confers resistance to zinc by facilitating vesicular sequestration.
Palmiter RD, etal., EMBO J 1996 Apr 15;15(8):1784-91.
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Slc30a2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 151,843,451 - 151,855,674 (+) NCBI GRCr8 mRatBN7.2 5 146,559,733 - 146,571,957 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 146,559,733 - 146,571,956 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 149,261,093 - 149,273,806 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 151,031,874 - 151,044,095 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 151,017,317 - 151,030,034 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 152,559,577 - 152,571,800 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 152,559,577 - 152,571,799 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 156,356,502 - 156,368,725 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 153,086,346 - 153,098,569 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 153,097,114 - 153,107,129 (+) NCBI Celera 5 144,977,168 - 144,989,389 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
SLC30A2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 26,037,252 - 26,046,118 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 26,037,252 - 26,046,118 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 26,363,743 - 26,372,609 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 26,237,101 - 26,245,191 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 26,048,655 - 26,056,746 NCBI Celera 1 24,761,192 - 24,769,282 (-) NCBI Celera Cytogenetic Map 1 p36.11 NCBI HuRef 1 24,618,624 - 24,626,717 (-) NCBI HuRef CHM1_1 1 26,477,743 - 26,485,833 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 25,874,654 - 25,883,519 (-) NCBI T2T-CHM13v2.0
Slc30a2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 134,070,357 - 134,081,795 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 134,070,492 - 134,081,795 (+) Ensembl GRCm39 Ensembl GRCm38 4 134,343,046 - 134,354,484 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 134,343,181 - 134,354,484 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 133,898,985 - 133,908,580 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 133,615,122 - 133,625,270 (+) NCBI MGSCv36 mm8 MGSCv36 4 131,918,527 - 131,928,675 (+) NCBI MGSCv36 mm8 Celera 4 132,522,807 - 132,532,421 (+) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 66.61 NCBI
Slc30a2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 5,504,022 - 5,516,246 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 5,507,614 - 5,515,669 (-) NCBI ChiLan1.0 ChiLan1.0
SLC30A2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 200,828,094 - 200,836,275 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 199,926,146 - 199,934,081 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 25,296,643 - 25,304,751 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 26,362,678 - 26,370,803 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 26,359,575 - 26,370,803 (-) Ensembl panpan1.1 panPan2
SLC30A2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 73,922,443 - 73,929,924 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 73,921,878 - 73,928,874 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 70,498,812 - 70,506,207 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 74,485,426 - 74,492,825 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 74,484,778 - 74,491,775 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 71,309,034 - 71,316,428 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 72,315,360 - 72,322,755 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 73,319,147 - 73,326,547 (+) NCBI UU_Cfam_GSD_1.0
Slc30a2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 44,756,722 - 44,764,976 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 10,581,480 - 10,589,442 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 10,581,504 - 10,589,364 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC30A2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 83,477,759 - 83,484,688 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 83,478,761 - 83,484,876 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 77,113,410 - 77,122,493 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC30A2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 106,722,539 - 106,731,494 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 106,724,256 - 106,731,955 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 9,686,150 - 9,695,043 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc30a2
.
Predicted Target Of
Count of predictions: 372 Count of miRNA genes: 130 Interacting mature miRNAs: 143 Transcripts: ENSRNOT00000022466, ENSRNOT00000071588 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH133009
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 146,571,687 - 146,571,878 (+) MAPPER mRatBN7.2 Rnor_6.0 5 152,571,531 - 152,571,721 NCBI Rnor6.0 Rnor_5.0 5 156,368,456 - 156,368,646 UniSTS Rnor5.0 RGSC_v3.4 5 153,098,300 - 153,098,490 UniSTS RGSC3.4 Celera 5 144,989,120 - 144,989,310 UniSTS RH 3.4 Map 5 988.4 UniSTS Cytogenetic Map 5 q36 UniSTS
RH140188
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 146,570,068 - 146,570,249 (+) MAPPER mRatBN7.2 Rnor_6.0 5 152,569,912 - 152,570,092 NCBI Rnor6.0 Rnor_5.0 5 156,366,837 - 156,367,017 UniSTS Rnor5.0 RGSC_v3.4 5 153,096,681 - 153,096,861 UniSTS RGSC3.4 Celera 5 144,987,501 - 144,987,681 UniSTS RH 3.4 Map 5 988.4 UniSTS Cytogenetic Map 5 q36 UniSTS
PMC61071P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 146,570,096 - 146,570,185 (+) MAPPER mRatBN7.2 Rnor_6.0 5 152,569,940 - 152,570,028 NCBI Rnor6.0 Rnor_5.0 5 156,366,865 - 156,366,953 UniSTS Rnor5.0 RGSC_v3.4 5 153,096,709 - 153,096,797 UniSTS RGSC3.4 Celera 5 144,987,529 - 144,987,617 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
86
82
87
56
25
56
6
209
91
72
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000082245 ⟹ ENSRNOP00000072908
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 146,559,733 - 146,571,956 (+) Ensembl Rnor_6.0 Ensembl 5 152,559,577 - 152,571,799 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113103 ⟹ ENSRNOP00000082820
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 146,559,733 - 146,571,956 (+) Ensembl
RefSeq Acc Id:
NM_001083122 ⟹ NP_001076591
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,843,451 - 151,855,674 (+) NCBI mRatBN7.2 5 146,559,733 - 146,571,957 (+) NCBI Rnor_6.0 5 152,559,577 - 152,571,800 (+) NCBI Rnor_5.0 5 156,356,502 - 156,368,725 (+) NCBI RGSC_v3.4 5 153,086,346 - 153,098,569 (+) RGD Celera 5 144,977,168 - 144,989,389 (+) RGD
Sequence:
GCTGAAAGTAGAAGGTGACTGCGAGCTGCCATCGTCCCGCGCGCAACTTCGAGGGCTCACCGGGAGAGGTGGCATGCAGACCATGGACAAGCAGAACCTGCTGGAGAGCACGCGCGGAGCCCGGTCTT
hide sequence
RefSeq Acc Id:
NM_012890 ⟹ NP_037022
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,844,181 - 151,855,674 (+) NCBI mRatBN7.2 5 146,560,463 - 146,571,957 (+) NCBI Rnor_6.0 5 152,560,307 - 152,571,800 (+) NCBI Rnor_5.0 5 156,356,502 - 156,368,725 (+) NCBI RGSC_v3.4 5 153,086,346 - 153,098,569 (+) RGD Celera 5 144,977,898 - 144,989,389 (+) NCBI
Sequence:
GCTCAGGGCTGCCTCCCTGCCTCCGGCCAAGCAATTTTTTCTGCCCTAACCCTGGCCTCCAGGT
hide sequence
RefSeq Acc Id:
NP_037022 ⟸ NM_012890
- Peptide Label:
isoform 2
- UniProtKB:
Q62941 (UniProtKB/Swiss-Prot), Q6P6V5 (UniProtKB/TrEMBL)
- Sequence:
MASRSFFGALWKSEASRIPPVNLPSVELAVQSNHYCHAQKDSGSHPNSEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQRAEILGAL
hide sequence
RefSeq Acc Id:
NP_001076591 ⟸ NM_001083122
- Peptide Label:
isoform 1
- UniProtKB:
B4F7D8 (UniProtKB/TrEMBL), Q6P6V5 (UniProtKB/TrEMBL)
- Sequence:
MQTMDKQNLLESTRGARSFFGALWKSEASRIPPVNLPSVELAVQSNHYCHAQKDSGSHPNSEKQRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTM
hide sequence
Ensembl Acc Id:
ENSRNOP00000072908 ⟸ ENSRNOT00000082245
Ensembl Acc Id:
ENSRNOP00000082820 ⟸ ENSRNOT00000113103
RGD ID: 13694135 Promoter ID: EPDNEW_R4660 Type: initiation region Name: Slc30a2_1 Description: solute carrier family 30 member 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 152,559,538 - 152,559,598 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-09
Slc30a2
solute carrier family 30 member 2
Slc30a2
solute carrier family 30 (zinc transporter), member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Slc30a2
solute carrier family 30 (zinc transporter), member 2
solute carrier family 30, member 2
Name updated
1299863 APPROVED
2003-04-09
Slc30a2
solute carrier family 30, member 2
Solute carrier family 30 (zinc transporter), member 2
Name updated
629478 APPROVED
2001-06-22
Znt2
Zink transporter 2
Symbol withdrawn, duplicate of Slc30a2 (RGD:3707)
67952 WITHDRAWN
2001-06-22
Slc30a2
Solute carrier family 30 (zinc transporter), member 3
Name updated
67952 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized on vesicles
730024
gene_expression
highly expressed in lateral and dorsal prostate gland; expression level is not affected by castration
1299032
gene_process
facilitates zinc transport into endosomal/lysosomal compartments, which may serve to protect cells from zinc toxicity
730024
gene_protein
359 amino acids
730024
