Advanced Search (OLGA)

Gene: Bpifa2 (BPI fold containing family A, member 2) Rattus norvegicus

Analyze

Symbol:

Bpifa2

Name:

BPI fold containing family A, member 2

RGD ID:

3431

Description:

Predicted to enable lipopolysaccharide binding activity. Predicted to be involved in defense response to bacterium. Located in secretory granule. Orthologous to human BPIFA2 (BPI fold containing family A member 2); INTERACTS WITH ammonium chloride; bisphenol A; flavonoids.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BPI fold containing family A, member 2E; BPI fold-containing family A member 2; Bpifa2e; neonatal submandibular gland protein; parotid secretory protein; Psp; short palate, lung and nasal epithelium carcinoma-associated protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	162,953,538 - 162,961,497 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	162,953,538 - 162,961,496 (+)	Ensembl				GRCr8
mRatBN7.2	3	142,493,379 - 142,501,343 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	142,493,379 - 142,501,337 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	146,395,290 - 146,403,248 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	154,979,124 - 154,987,082 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	152,719,372 - 152,727,330 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	149,492,612 - 149,501,614 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	149,493,655 - 149,501,613 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	155,871,130 - 155,879,088 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	144,395,541 - 144,403,499 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	141,234,747 - 141,242,705 (+)	NCBI		Celera
RGSC_v3.1	3	144,301,162 - 144,309,121 (+)	NCBI
RH 3.4 Map	3	1289.6	RGD
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3-methylcholanthrene (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

calcitriol (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

flavonoids (EXP)

furan (EXP)

nonanoic acid (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

sodium arsenite (ISO)

toluene 2,4-diisocyanate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to bacterium (IEA)

Cellular Component

extracellular region (IEA,ISO)

extracellular space (ISO)

secretory granule (IBA,IDA)

Molecular Function

lipid binding (IEA)

lipopolysaccharide binding (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Sorting of an exocrine secretory protein to the regulated secretory pathway in endocrine cells.	Cowley DJ, etal., Biochem Biophys Res Commun 2002 Nov 22;299(1):98-101.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Neonatal rat submandibular gland protein SMG-A and parotid secretory protein are alternatively regulated members of a salivary protein multigene family.	Mirels L and Ball WD, J Biol Chem 1992 Feb 5;267(4):2679-87.
6.	Characterization of the rat salivary-gland B1-immunoreactive proteins.	Mirels L, etal., Biochem J 1998 Feb 15;330 ( Pt 1):437-44.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:14739326	PMID:17537806	PMID:19199708	PMID:19499239	PMID:19642100	PMID:21787333	PMID:21833535

Genomics

Comparative Map Data

Bpifa2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	162,953,538 - 162,961,497 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	162,953,538 - 162,961,496 (+)	Ensembl				GRCr8
mRatBN7.2	3	142,493,379 - 142,501,343 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	142,493,379 - 142,501,337 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	146,395,290 - 146,403,248 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	154,979,124 - 154,987,082 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	152,719,372 - 152,727,330 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	149,492,612 - 149,501,614 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	149,493,655 - 149,501,613 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	155,871,130 - 155,879,088 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	144,395,541 - 144,403,499 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	141,234,747 - 141,242,705 (+)	NCBI		Celera
RGSC_v3.1	3	144,301,162 - 144,309,121 (+)	NCBI
RH 3.4 Map	3	1289.6	RGD
Cytogenetic Map	3	q41	NCBI

BPIFA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	33,161,770 - 33,181,412 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	33,161,768 - 33,181,412 (+)	Ensembl			hg38	GRCh38
GRCh37	20	31,749,576 - 31,769,218 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	31,219,621 - 31,232,884 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	31,219,620 - 31,232,884	NCBI
Celera	20	28,509,850 - 28,523,113 (+)	NCBI		Celera
Cytogenetic Map	20	q11.21	NCBI
HuRef	20	28,543,601 - 28,556,864 (+)	NCBI		HuRef
CHM1_1	20	31,657,069 - 31,670,332 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	34,888,999 - 34,908,644 (+)	NCBI		T2T-CHM13v2.0

Bpifa2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	153,850,196 - 153,857,993 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	153,850,185 - 153,857,999 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	154,008,276 - 154,016,073 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	154,008,265 - 154,016,079 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	153,834,012 - 153,841,809 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	153,699,717 - 153,707,514 (+)	NCBI		MGSCv36	mm8
Celera	2	159,844,480 - 159,852,271 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	76.15	NCBI

BPIFA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	38,861,535 - 38,874,752 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	38,854,633 - 38,867,850 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	29,451,478 - 29,471,183 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	30,567,770 - 30,587,307 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	30,574,024 - 30,587,307 (+)	Ensembl			panPan2	panpan1.1

BPIFA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	22,413,324 - 22,423,717 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	22,413,272 - 22,423,646 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	22,058,860 - 22,069,311 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	23,099,011 - 23,109,457 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	23,099,020 - 23,109,386 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	22,374,559 - 22,385,013 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	22,484,616 - 22,495,072 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	22,915,724 - 22,926,167 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

BPIFA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	36,690,008 - 36,699,988 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	36,690,008 - 36,699,989 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	41,597,327 - 41,650,291 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	17	q21-q23	NCBI

BPIFA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	37,509,463 - 37,521,300 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	37,509,635 - 37,520,281 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	89,381,188 - 89,400,119 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bpifa2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624842	6,135,792 - 6,142,168 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Bpifa2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	133,345,599 - 133,353,690 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Bpifa2
43 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	34
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000018226
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	151075912	189428310	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161492708	189428310	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	161799493	176036425	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	161799270	187311134	Rat
1582213	Insul6	Insulin level QTL 6	3.7	0.0009	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	141508991	166376254	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	152055202	189428310	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
1582256	Insul9	Insulin level QTL 9	4.4	0.0016	blood insulin amount (VT:0001560)	absolute change in serum insulin level (CMO:0002038)	3	155759447	189428310	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
1582248	Insul7	Insulin level QTL 7	3.9	0.0041	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	3	155759447	189428310	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	151075912	189428310	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	151075912	189428310	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	160357340	167835660	Rat

Markers in Region

D3Wox37

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	142,491,933 - 142,492,163 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	149,492,210 - 149,492,439	NCBI	Rnor6.0
Rnor_5.0	3	155,869,685 - 155,869,914	UniSTS	Rnor5.0
RGSC_v3.4	3	144,394,096 - 144,394,325	UniSTS	RGSC3.4
Celera	3	141,233,302 - 141,233,531	UniSTS
Cytogenetic Map	3	q41-q42	UniSTS

RH142217

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	142,500,135 - 142,501,326 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	149,500,412 - 149,501,602	NCBI	Rnor6.0
Rnor_5.0	3	155,877,887 - 155,879,077	UniSTS	Rnor5.0
RGSC_v3.4	3	144,402,298 - 144,403,488	UniSTS	RGSC3.4
Celera	3	141,241,504 - 141,242,694	UniSTS
RH 3.4 Map	3	1289.6	UniSTS
Cytogenetic Map	3	q41-q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
3	2	6	3	23	26	23	43	23	1	79	51	3	1	1	9	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_052808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF153354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M83209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018226 ⟹ ENSRNOP00000018226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	162,953,538 - 162,961,496 (+)	Ensembl
mRatBN7.2 Ensembl	3	142,493,379 - 142,501,337 (+)	Ensembl
Rnor_6.0 Ensembl	3	149,493,655 - 149,501,613 (+)	Ensembl

RefSeq Acc Id:

NM_052808 ⟹ NP_434695

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	162,953,538 - 162,961,496 (+)	NCBI
mRatBN7.2	3	142,493,379 - 142,501,337 (+)	NCBI
Rnor_6.0	3	149,493,655 - 149,501,613 (+)	NCBI
Rnor_5.0	3	155,871,130 - 155,879,088 (+)	NCBI
RGSC_v3.4	3	144,395,541 - 144,403,499 (+)	RGD
Celera	3	141,234,747 - 141,242,705 (+)	RGD

Sequence:

show sequence

GAGAAACAAGGCTTTCCTGTCCTTCCTTCTCCAAACCAAACCAAAGATGTTCCAACTTGGGAGC
CTTGTGGTCTTGTGTGGCCTGCTTATTGGGACCTCAGAATCACTTCTTGGTGACGTTGCCAATG
CTGTGAATAATTTGGACATTCTTAATTCTCCCTCTGAAGCTGTCGCTCAGAATCTGAATCTGGA
TGTGGGGTCACTTCAGCAAGCCACAACTTGGCCATCAGCCAAGGACAGCATTCTTGAAACATTG
AACAAAGTGGAGCTTGGCAATTCAAATGGCTTTACACCTTTGAATGGTTTATTGTTGCGAGTCA
ATAAATTTAGAGTCCTGGATCTTCAAGCTGGGCTGTCTTCCAATGGCAAGGACATCGACCTGAA
ACTGCCCCTGGTTTTTGAAATTTCTTTTTCTCTGCCTGTCATTGGCCCTACGCTCGACGTTGCT
GTTTCCTTGGACCTCCTAAACTCAGTCAGTGTTCAAACCAATGCCCAGACTGGCCTCCCTGGGG
TGACCCTAGGAAAATGCTCCGGTAATACAGACAAAATCTCCATTTCCTTGTTGGGCAGACGACT
TCCCTTCGTCAACCGTATTCTGGATGGTGTATCTGGCCTCCTCACAGGTGCAGTGTCAATCCTG
CTGCAAAACATCCTATGCCCAGTGCTCCAGTACCTCCTCAGCACAATGAGTGGAAGTGCTATTC
AGGGTCTCCTCTCTAATGTACTAACAGGACAGCTAGCAGTCCCTCTCTGAAGAGGAAGAACAGA
AGGAGGAAGCCATGACAACCCCTGCTGGTTAGTCTCCACTGGCTTTATTTTACTTCCGGTGGCA
TTTCTTTCTGGGAAGTTCTACTATCATCCACACAAAGTCTACCTGATACCAACGGAAGGACTTT
CCCAGATTCCCTTCTTTCCTGAGTAGTCTCCACACCTGTCACCACCATCATTAAAATCCTAACT
GC

hide sequence

RefSeq Acc Id:

XM_039105730 ⟹ XP_038961658

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	162,954,086 - 162,961,497 (+)	NCBI
mRatBN7.2	3	142,493,926 - 142,501,343 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_434695	(Get FASTA)	NCBI Sequence Viewer
	XP_038961658	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC06334	(Get FASTA)	NCBI Sequence Viewer
	EDL85982	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018226
	ENSRNOP00000018226.1
GenBank Protein	Q63471	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_434695 ⟸ NM_052808
- Peptide Label:	precursor
- UniProtKB:	Q63471 (UniProtKB/Swiss-Prot), A6KHX3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFQLGSLVVLCGLLIGTSESLLGDVANAVNNLDILNSPSEAVAQNLNLDVGSLQQATTWPSAKD SILETLNKVELGNSNGFTPLNGLLLRVNKFRVLDLQAGLSSNGKDIDLKLPLVFEISFSLPVIG PTLDVAVSLDLLNSVSVQTNAQTGLPGVTLGKCSGNTDKISISLLGRRLPFVNRILDGVSGLLT GAVSILLQNILCPVLQYLLSTMSGSAIQGLLSNVLTGQLAVPL hide sequence

Ensembl Acc Id:

ENSRNOP00000018226 ⟸ ENSRNOT00000018226

RefSeq Acc Id:	XP_038961658 ⟸ XM_039105730
- Peptide Label:	isoform X1

Protein Domains

Lipid-binding serum glycoprotein N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63471-F1-model_v2	AlphaFold	Q63471	1-235	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3431	AgrOrtholog
BioCyc Gene	G2FUF-47195	BioCyc
Ensembl Genes	ENSRNOG00000013540	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018226	ENTREZGENE
	ENSRNOT00000018226.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Bactericidal permeability-increasing protein, domain 1	UniProtKB/Swiss-Prot
InterPro	Bactericidal_perm-incr_a/b_dom	UniProtKB/Swiss-Prot
	BPI_fold-antibacterial	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_N	UniProtKB/Swiss-Prot
KEGG Report	rno:50585	UniProtKB/Swiss-Prot
NCBI Gene	50585	ENTREZGENE
PANTHER	BPI FOLD-CONTAINING FAMILY A MEMBER 2	UniProtKB/Swiss-Prot
	BPI FOLD-CONTAINING FAMILY A MEMBER 2	UniProtKB/Swiss-Prot
Pfam	LBP_BPI_CETP	UniProtKB/Swiss-Prot
PhenoGen	Bpifa2	PhenoGen
RatGTEx	ENSRNOG00000013540	RatGTEx
Superfamily-SCOP	SSF55394	UniProtKB/Swiss-Prot
UniProt	A6KHX3	ENTREZGENE, UniProtKB/TrEMBL
	BPIA2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-16	Bpifa2	BPI fold containing family A, member 2	Psp	parotid secretory protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-01	Bpifa2e	BPI fold containing family A, member 2E	Psp	parotid secretory protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-01	Psp	parotid secretory protein	Bpifa2e	BPI fold containing family A, member 2E	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Psp	Parotid Secretory Protein			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in submandibular gland acinar-cell progenitors, sublingual and parotid glands	633796

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD