Advanced Search (OLGA)

Gene: Grpr (gastrin releasing peptide receptor) Rattus norvegicus

Analyze

Symbol:

Grpr

Name:

gastrin releasing peptide receptor

RGD ID:

2750

Description:

Enables G protein-coupled receptor activity and neuropeptide binding activity. Involved in G protein-coupled receptor signaling pathway; learning or memory; and social behavior. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human GRPR (gastrin releasing peptide receptor); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH ammonium chloride; bisphenol A; bleomycin A2.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Gastrin-releasing peptide receptor; GRP-preferring bombesin receptor; GRP-R

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GRPR (gastrin releasing peptide receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Grpr (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Grpr (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GRPR (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GRPR (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Grpr (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GRPR (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GRPR (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Grpr (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Grpr (gastrin releasing peptide receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GRPR (gastrin releasing peptide receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Grpr (gastrin releasing peptide receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	grpr (gastrin-releasing peptide receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CCHa1-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CCHa2-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CCHa2-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	grpr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	34,630,238 - 34,670,245 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	34,630,229 - 34,670,245 (+)	Ensembl				GRCr8
mRatBN7.2	X	30,998,425 - 31,038,442 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	30,998,416 - 31,038,442 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	32,038,434 - 32,078,466 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	35,468,323 - 35,508,331 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	31,669,805 - 31,709,843 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	32,746,259 - 32,786,266 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	32,745,873 - 32,786,359 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	33,083,317 - 33,123,324 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	51,743,248 - 51,783,255 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	31,324,305 - 31,364,289 (+)	NCBI		Celera
RGSC_v3.1	X	51,796,714 - 51,836,724 (+)	NCBI
Cytogenetic Map	X	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Memory Disorders (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

6-aminohexanoate (ISO)

6-aminohexanoic acid (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bleomycin A2 (EXP)

caffeine (EXP)

carbon nanotube (ISO)

clofibrate (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

cytarabine (ISO)

dextran sulfate (ISO)

dichloroacetic acid (ISO)

diquat (ISO)

folic acid (ISO)

genistein (EXP)

kuwanone G (ISO)

kuwanone H (ISO)

lipopolysaccharide (ISO)

methoxyacetic acid (EXP)

methoxychlor (EXP)

methylmercury chloride (EXP,ISO)

Monobutylphthalate (EXP)

N-ethyl-N-nitrosourea (EXP)

Nonylphenol (EXP)

ozone (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

tunicamycin (ISO)

U50488 (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bombesin receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway (IBA,IDA,IEA)

learning or memory (IMP)

motor behavior (IEA,ISO,ISS)

neuropeptide signaling pathway (IEA)

phospholipase C-activating G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

positive regulation of behavioral fear response (IEA,ISO,ISS)

positive regulation of respiratory gaseous exchange (IEA,ISO,ISS)

psychomotor behavior (IEA,ISO)

regulation of cell population proliferation (ISO)

response to external biotic stimulus (IEA,ISO)

signal transduction (IEA)

social behavior (IEA,IMP,ISO,ISS)

Cellular Component

membrane (IEA)

plasma membrane (IBA,IEA,ISO,ISS)

Molecular Function

bombesin receptor activity (IEA,TAS)

G protein-coupled peptide receptor activity (IEA,ISO)

G protein-coupled receptor activity (IDA,IEA)

neuropeptide binding (IDA)

neuropeptide receptor activity (IBA,IEA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Gastrin-releasing peptide receptor in rat brain membranes: specific binding and stimulation of phosphoinositide breakdown.	Hollingsworth EB Mol Pharmacol. 1989 May;35(5):689-94.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	Impairments of social behavior and memory after neonatal gastrin-releasing peptide receptor blockade in rats: Implications for an animal model of neurodevelopmental disorders.	Presti-Torres J, etal., Neuropharmacology. 2007 Mar;52(3):724-32. Epub 2006 Nov 13.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Molecular basis for selectivity of high affinity peptide antagonists for the gastrin-releasing peptide receptor.	Tokita K, etal., J Biol Chem 2001 Sep 28;276(39):36652-63.

Additional References at PubMed

PMID:1327030	PMID:1655761	PMID:1671171	PMID:11960700	PMID:15140764	PMID:17406984	PMID:19912888	PMID:22429708	PMID:22735756	PMID:26658875	PMID:26855425	PMID:28280205
PMID:37604300

Genomics

Comparative Map Data

Grpr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	34,630,238 - 34,670,245 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	34,630,229 - 34,670,245 (+)	Ensembl				GRCr8
mRatBN7.2	X	30,998,425 - 31,038,442 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	30,998,416 - 31,038,442 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	32,038,434 - 32,078,466 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	35,468,323 - 35,508,331 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	31,669,805 - 31,709,843 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	32,746,259 - 32,786,266 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	32,745,873 - 32,786,359 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	33,083,317 - 33,123,324 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	51,743,248 - 51,783,255 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	31,324,305 - 31,364,289 (+)	NCBI		Celera
RGSC_v3.1	X	51,796,714 - 51,836,724 (+)	NCBI
Cytogenetic Map	X	q14	NCBI

GRPR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	16,123,565 - 16,153,518 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	16,123,565 - 16,153,518 (+)	Ensembl			hg38	GRCh38
GRCh37	X	16,141,688 - 16,171,641 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	16,051,345 - 16,081,562 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	X	15,901,335 - 15,930,598	NCBI
Celera	X	20,259,707 - 20,289,922 (+)	NCBI		Celera
Cytogenetic Map	X	p22.2	NCBI
HuRef	X	13,896,945 - 13,927,133 (+)	NCBI		HuRef
CHM1_1	X	16,172,364 - 16,202,581 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	15,706,468 - 15,736,420 (+)	NCBI		T2T-CHM13v2.0

Grpr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	162,296,900 - 162,332,732 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	162,296,900 - 162,332,673 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	X	163,513,904 - 163,549,736 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	163,513,904 - 163,549,677 (-)	Ensembl			mm10	GRCm38
MGSCv37	X	159,951,836 - 159,987,579 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	X	158,858,009 - 158,893,752 (-)	NCBI		MGSCv36	mm8
Celera	X	146,739,026 - 146,774,660 (-)	NCBI		Celera
Cytogenetic Map	X	F5	NCBI
cM Map	X	75.63	NCBI

Grpr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955519	2,032,500 - 2,063,292 (-)	Ensembl
ChiLan1.0	NW_004955519	2,032,500 - 2,063,292 (-)	NCBI	ChiLan1.0	ChiLan1.0

GRPR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	17,916,672 - 17,960,806 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	17,920,074 - 17,949,208 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	8,744,020 - 8,775,085 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	16,099,778 - 16,131,069 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	16,099,778 - 16,131,069 (+)	Ensembl			panPan2	panpan1.1

GRPR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	12,344,704 - 12,381,445 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	12,345,318 - 12,380,915 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	12,194,783 - 12,232,039 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	12,305,424 - 12,342,697 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	12,306,033 - 12,342,171 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	12,374,968 - 12,412,213 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	12,361,417 - 12,398,693 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	12,387,955 - 12,425,227 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Grpr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	5,533,131 - 5,565,860 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	5,533,256 - 5,565,869 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	5,533,256 - 5,565,827 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GRPR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	12,659,776 - 12,696,103 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	X	12,654,059 - 12,711,417 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	13,603,713 - 13,650,148 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GRPR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	14,569,771 - 14,599,306 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	14,570,453 - 14,599,258 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666056	16,425,059 - 16,455,086 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Grpr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624829	907,371 - 939,779 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624829	907,386 - 946,385 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Grpr
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	X	24,107,436 - 24,151,898 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Grpr
80 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	29
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000005559
Prediction methods:	Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598873	Memor2	Memory QTL 2	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	X	24470360	44931007	Rat
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	4001493	44939387	Rat
2290375	Gluco34	Glucose level QTL 34	2.75		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	24470360	45082063	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1970440	46970440	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	8111486	53111486	Rat

Markers in Region

DXWox17

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	31,035,144 - 31,035,347 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	32,782,973 - 32,783,175	NCBI	Rnor6.0
Rnor_5.0	X	33,120,031 - 33,120,233	UniSTS	Rnor5.0
RGSC_v3.4	X	51,779,962 - 51,780,164	UniSTS	RGSC3.4
Celera	X	31,360,995 - 31,361,197	UniSTS
Cytogenetic Map	X	q21	UniSTS

DXArb10

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	X	34,630,021 - 34,630,209 (+)	Marker Load Pipeline
mRatBN7.2	X	30,998,206 - 30,998,396 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	32,746,043 - 32,746,230	NCBI	Rnor6.0
Rnor_5.0	X	33,083,101 - 33,083,288	UniSTS	Rnor5.0
RGSC_v3.4	X	51,743,030 - 51,743,219	UniSTS	RGSC3.4
RGSC_v3.4	X	51,743,029 - 51,743,219	RGD	RGSC3.4
Celera	X	31,324,089 - 31,324,276	UniSTS
RGSC_v3.1	X	51,796,498 - 51,796,688	RGD
FHH x ACI Map	X	14.5099	UniSTS
FHH x ACI Map	X	14.5099	RGD
Cytogenetic Map	X	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	11	38	124	72	71	40	29	40	6	210	92	2	102	60	83	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X56661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005559 ⟹ ENSRNOP00000005559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	34,630,229 - 34,670,245 (+)	Ensembl
mRatBN7.2 Ensembl	X	30,998,416 - 31,038,442 (+)	Ensembl
Rnor_6.0 Ensembl	X	32,745,873 - 32,786,359 (+)	Ensembl

RefSeq Acc Id:

NM_012706 ⟹ NP_036838

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	34,630,238 - 34,670,245 (+)	NCBI
mRatBN7.2	X	30,998,425 - 31,038,442 (+)	NCBI
Rnor_6.0	X	32,746,259 - 32,786,266 (+)	NCBI
Rnor_5.0	X	33,083,317 - 33,123,324 (+)	NCBI
RGSC_v3.4	X	51,743,248 - 51,783,255 (+)	RGD
Celera	X	31,324,305 - 31,364,289 (+)	RGD

Sequence:

show sequence

AAGTTACAAAGCAGCATCTTGAAGGCGCATTTGAAGAGAGAAGCTTTGAGATGGATCCAAATAA
TTGTTCCCACCTGAACTTGGAAGTGGATCCTTTCCTGTCCTGCAACAACACCTTCAATCAAACT
CTGAGTCCCCCCAAGATGGACAACTGGTTTCACCCGGGAATCATCTATGTCATTCCTGCAGTTT
ATGGGCTTATCATCGTGATAGGCCTCATTGGCAACATCACCCTGATCAAGATCTTCTGTACGGT
CAAGTCCATGCGAAACGTGCCAAACCTGTTCATCTCTAGCCTGGCATTGGGAGACCTACTGCTG
CTGGTTACATGCGCCCCTGTGGATGCCAGCAAGTACCTGGCTGACAGGTGGCTATTTGGCAGGA
TTGGCTGCAAACTGATCCCCTTTATACAACTTACTTCAGTGGGGGTGTCTGTCTTCACACTTAC
GGCACTGTCAGCTGACAGGTACAAAGCCATCGTCAGGCCAATGGATATCCAGGCATCCCATGCC
CTGATGAAGATCTGTCTCAAAGCTGCCTTAATCTGGATCGTCTCTATGCTGTTGGCCATCCCAG
AGGCTGTATTTTCGGACCTTCACCCCTTTCATGTGAAAGATACCAACCAAACCTTCATTAGTTG
TGCCCCCTACCCACACTCCAATGAGCTGCACCCTAAAATCCATTCCATGGCTTCCTTTCTGGTC
TTTTACATTATCCCACTGTCGATCATCTCTGTCTACTACTACTTCATTGCCCGAAATCTGATTC
AGAGTGCCTACAATCTTCCTGTGGAAGGAAATATACATGTCAAGAAGCAGATCGAATCCCGGAA
GCGGCTTGCCAAGACAGTACTGGTGTTTGTGGGCCTCTTCGCCTTCTGCTGGCTCCCCAATCAT
GTCATCTACCTGTACCGTTCCTACCACTACTCTGAGGTGGACACCTCCATGCTCCACTTTATCA
CCAGCATCTGTGCCCGCCTCCTGGCCTTCACCAACTCCTGTGTGAACCCCTTTGCCCTGTATCT
GCTGAGCAAGAGCTTCAGGAAGCAGTTCAACACTCAACTTCTCTGCTGCCAGCCCAGCCTGTTG
AACAGGTCTCACAGCACAGGCAGAAGTACCACCTGCATGACCTCCTTCAAGAGCACCAACCCCT
CAGCTACCTTCAGCCTCATCAACGGAAATATCTGCCATGAGGGGTATGTCTAGACAAACCTTCA
GCCTCGACTCTTAAGGAACTCCTGGTACTATTCTACAGATATCTAGGATCCCTGAAATTGATTG
TTGTCTCTATACCTTCCAAAGACCCTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_036838	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA39988	(Get FASTA)	NCBI Sequence Viewer
	EDL90503	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005559
	ENSRNOP00000005559.4
GenBank Protein	P52500	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036838 ⟸ NM_012706

- UniProtKB:

P52500 (UniProtKB/Swiss-Prot), G3V6I7 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDPNNCSHLNLEVDPFLSCNNTFNQTLSPPKMDNWFHPGIIYVIPAVYGLIIVIGLIGNITLIK
IFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVS
VFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQ
TFISCAPYPHSNELHPKIHSMASFLVFYIIPLSIISVYYYFIARNLIQSAYNLPVEGNIHVKKQ
IESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFITSICARLLAFTNSCVNP
FALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGRSTTCMTSFKSTNPSATFSLINGNICHEGYV

hide sequence

Ensembl Acc Id:

ENSRNOP00000005559 ⟸ ENSRNOT00000005559

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52500-F1-model_v2	AlphaFold	P52500	1-384	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2750	AgrOrtholog
BioCyc Gene	G2FUF-2556	BioCyc
Ensembl Genes	ENSRNOG00000004124	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005559	ENTREZGENE
	ENSRNOT00000005559.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	Bombsn_rcpt-like	UniProtKB/Swiss-Prot
	Gastrin_pep_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:24938	UniProtKB/Swiss-Prot
NCBI Gene	24938	ENTREZGENE
PANTHER	GASTRIN-RELEASING PEPTIDE RECEPTOR	UniProtKB/Swiss-Prot
	LEUCOKININ RECEPTOR-RELATED	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Grpr	PhenoGen
PRINTS	BOMBESINR	UniProtKB/Swiss-Prot
	GASTRINRELPR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004124	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	G3V6I7	ENTREZGENE
	GRPR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	G3V6I7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Grpr	Gastrin-releasing peptide receptor			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the cell membrane	734489
gene_domains	Thr(297), Phe(302), and Ser(305) of the fourth EC domain are the critical residues for determining receptor selectivity	734489

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)