Advanced Search (OLGA)

Gene: Chga (chromogranin A) Rattus norvegicus

Analyze

Symbol:

Chga

Name:

chromogranin A

RGD ID:

2338

Description:

Involved in several processes, including positive regulation of relaxation of cardiac muscle; positive regulation of signal transduction; and regulation of blood circulation. Located in chromaffin granule; extracellular space; and neuronal dense core vesicle. Biomarker of hypertension. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; end stage renal disease; hypertension; and prostate cancer. Orthologous to human CHGA (chromogranin A); PARTICIPATES IN G protein mediated signaling pathway; INTERACTS WITH (S)-nicotine; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cgA; chromogranin A (parathyroid secretory protein 1); Chromogranin A parathyroid secretory protein 1; chromogranin A precursor; Chromogranin A, parathyroid secretory protein 1; chromogranin A-like; chromogranin-A; MGC105435

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHGA (chromogranin A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Chga (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chga (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHGA (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHGA (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chga (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHGA (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHGA (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chga (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Chga (chromogranin A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PRSS36 (serine protease 36)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Chga (chromogranin A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CHGA (chromogranin A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chga (chromogranin A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chga	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chga	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	127,460,895 - 127,472,238 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	127,460,854 - 127,472,237 (+)	Ensembl				GRCr8
mRatBN7.2	6	121,696,051 - 121,707,399 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	121,696,051 - 121,707,398 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	121,834,591 - 121,845,883 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	122,129,839 - 122,141,131 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	121,466,197 - 121,477,529 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	126,434,226 - 126,445,569 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	126,434,226 - 126,445,568 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	135,645,155 - 135,656,373 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	6	119,184,838 - 119,196,152 (+)	NCBI		Celera
RGSC_v3.1	6	126,825,283 - 126,836,311 (+)	NCBI
RH 3.4 Map	6	845.4	RGD
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

basal cell carcinoma (ISO)

end stage renal disease (ISO)

hypertension (IEP,ISO)

IgA glomerulonephritis (ISO)

lung non-small cell carcinoma (ISO)

pheochromocytoma (ISO)

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP,ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

atrazine (ISO)

B 823-08 (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

cetrorelix (ISO)

CGP 52608 (ISO)

chlorisondamine (ISO)

chlorpyrifos (EXP)

clozapine (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclophosphamide (ISO)

DDE (EXP)

dextran sulfate (ISO)

diazinon (EXP)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

disodium selenite (ISO)

disulfiram (ISO)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (EXP)

ethanol (ISO)

Evodiamine (ISO)

folic acid (ISO)

furan (EXP)

furosemide (EXP)

hexanal (EXP)

lead(0) (ISO)

linuron (EXP)

lipopolysaccharide (ISO)

lithium chloride (ISO)

lycopene (ISO)

maneb (ISO)

methoxychlor (EXP)

methylphenidate (ISO)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (EXP)

nicotine (EXP,ISO)

okadaic acid (ISO)

Oxotremorine (EXP)

panobinostat (ISO)

paracetamol (ISO)

paraquat (ISO)

phenylmercury acetate (ISO)

prochloraz (EXP)

procymidone (EXP)

progesterone (ISO)

reserpine (EXP,ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

Securinine (ISO)

sodium arsenite (ISO)

streptozocin (ISO)

Sunset Yellow FCF (ISO)

testosterone enanthate (ISO)

thapsigargin (EXP,ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to bacterium (IBA)

defense response to Gram-negative bacterium (IEA,ISO,ISS)

defense response to Gram-positive bacterium (IEA,ISO,ISS)

mast cell activation (IEA,ISO,ISS)

mast cell chemotaxis (IEA,ISO,ISS)

mast cell degranulation (IEA,ISO,ISS)

negative regulation of catecholamine secretion (IBA,IEA,ISO,ISS)

negative regulation of cellular process (IDA)

negative regulation of insulin secretion (IBA)

ovulation cycle (IEP)

positive regulation of cAMP/PKA signal transduction (IDA)

positive regulation of cardiac muscle contraction (IDA)

positive regulation of dense core granule biogenesis (IEA,ISO,ISS)

positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway (IDA)

positive regulation of protein phosphorylation (IDA)

positive regulation of relaxation of cardiac muscle (IDA)

positive regulation of vasoconstriction (IDA)

protein localization to secretory granule (ISO)

regulation of cytosolic calcium ion concentration (IDA)

regulation of the force of heart contraction (IDA)

Cellular Component

chromaffin granule (IBA,IDA)

cytoplasmic vesicle (IEA)

extracellular region (IEA)

extracellular space (IBA,IDA)

neuronal dense core vesicle (IDA,IEA)

perinuclear region of cytoplasm (IEA,ISO)

secretory granule (IDA,IEA)

transport vesicle (IEA)

Molecular Function

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

G protein mediated signaling pathway (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Capture of Dense Core Vesicles at Synapses by JNK-Dependent Phosphorylation of Synaptotagmin-4.	Bharat V, etal., Cell Rep. 2017 Nov 21;21(8):2118-2133. doi: 10.1016/j.celrep.2017.10.084.
2.	Cathepsin L colocalizes with chromogranin a in chromaffin vesicles to generate active peptides.	Biswas N, etal., Endocrinology. 2009 Aug;150(8):3547-57. Epub 2009 Apr 16.
3.	Naturally occurring genetic variants in human chromogranin A (CHGA) associated with hypertension as well as hypertensive renal disease.	Chen Y, etal., Cell Mol Neurobiol. 2010 Nov;30(8):1395-400.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Role of reactive oxygen species in hyperadrenergic hypertension: biochemical, physiological, and pharmacological evidence from targeted ablation of the chromogranin a (Chga) gene.	Gayen JR, etal., Circ Cardiovasc Genet. 2010 Oct;3(5):414-25. Epub 2010 Aug 20.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Pancreastatin, a chromogranin A-derived peptide, activates protein synthesis signaling cascade in rat adipocytes.	Gonzalez-Yanes C and Sanchez-Margalet V, Biochem Biophys Res Commun 2002 Dec 13;299(4):525-31.
8.	Pancreastatin, a chromogranin A-derived peptide, activates Galpha(16) and phospholipase C-beta(2) by interacting with specific receptors in rat heart membranes.	Gonzalez-Yanes C, etal., Cell Signal. 2001 Jan;13(1):43-9.
9.	Identification of a chromogranin A domain that mediates binding to secretogranin III and targeting to secretory granules in pituitary cells and pancreatic beta-cells.	Hosaka M, etal., Mol Biol Cell. 2002 Oct;13(10):3388-99.
10.	Chromogranin A in familial pheochromocytoma: diagnostic screening value, prediction of tumor mass, and post-resection kinetics indicating two-compartment distribution.	Hsiao RJ, etal., Am J Med. 1990 Jun;88(6):607-13.
11.	Primary structure of rat chromogranin A and distribution of its mRNA.	Iacangelo A, etal., FEBS Lett 1988 Jan 25;227(2):115-21.
12.	Large dense-core secretory granule biogenesis is under the control of chromogranin A in neuroendocrine cells.	Kim T, etal., Ann N Y Acad Sci 2002 Oct;971:323-31.
13.	Role of pGlu-serpinin, a novel chromogranin A-derived peptide in inhibition of cell death.	Koshimizu H, etal., J Mol Neurosci. 2011 Oct;45(2):294-303. Epub 2011 May 3.
14.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
15.	Clinical significance of polymorphism and expression of chromogranin a and endothelin-1 in prostate cancer.	Ma Z, etal., J Urol. 2010 Sep;184(3):1182-8. Epub 2010 Jul 21.
16.	Chromogranin A-derived peptides: interaction with the rat posterior cerebral artery.	Mandala M, etal., Regul Pept. 2005 Jan 15;124(1-3):73-80.
17.	Chromogranin A proteolysis to generate beta-granin and WE-14 in the adenohypophysis during the rat oestrous cycle.	McVicar CM, etal., Regul Pept. 2003 Aug 15;115(1):1-10.
18.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
19.	Evaluation of chromogranin A determined by three different procedures in patients with benign diseases, neuroendocrine tumors and other malignancies.	Molina R, etal., Tumour Biol. 2011 Feb;32(1):13-22. Epub 2010 Aug 21.
20.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.	Catecholamine storage vesicle protein expression in genetic hypertension.	O'Connor DT, etal., Blood Press. 1999;8(5-6):285-95.
22.	Molecular cloning of chromogranin A from rat pheochromocytoma cells.	Parmer RJ, etal., Hypertension 1989 Oct;14(4):435-44.
23.	GOA pipeline	RGD automated data pipeline
24.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
26.	Comprehensive gene review and curation	RGD comprehensive gene curation
27.	Chromogranin A polymorphisms are associated with hypertensive renal disease.	Salem RM, etal., J Am Soc Nephrol. 2008 Mar;19(3):600-14. Epub 2008 Jan 30.
28.	The novel chromogranin A-derived serpinin and pyroglutaminated serpinin peptides are positive cardiac beta-adrenergic-like inotropes.	Tota B, etal., FASEB J. 2012 Jul;26(7):2888-98. Epub 2012 Mar 29.
29.	Expression of chromogranin/secretogranin mRNA in spontaneous mammary tumors in aging Fischer-344 rats.	Umemura S, etal., Pathol Int 2001 Sep;51(9):667-70.
30.	Common genetic variants in the chromogranin a promoter are associated with renal injury in IgA nephropathy patients with malignant hypertension.	Yu L, etal., Ren Fail. 2010 Jan;32(1):41-6.

Additional References at PubMed

PMID:3044825	PMID:3896848	PMID:12242039	PMID:12397377	PMID:12477932	PMID:12646581	PMID:12902350	PMID:15326220	PMID:15723172	PMID:16219686	PMID:17540723	PMID:18483175
PMID:18697842	PMID:18802106	PMID:19800883	PMID:20862257	PMID:21214543	PMID:21436258	PMID:23674521	PMID:23751870

Genomics

Comparative Map Data

Chga
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	127,460,895 - 127,472,238 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	127,460,854 - 127,472,237 (+)	Ensembl				GRCr8
mRatBN7.2	6	121,696,051 - 121,707,399 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	121,696,051 - 121,707,398 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	121,834,591 - 121,845,883 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	122,129,839 - 122,141,131 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	121,466,197 - 121,477,529 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	126,434,226 - 126,445,569 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	126,434,226 - 126,445,568 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	135,645,155 - 135,656,373 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	6	119,184,838 - 119,196,152 (+)	NCBI		Celera
RGSC_v3.1	6	126,825,283 - 126,836,311 (+)	NCBI
RH 3.4 Map	6	845.4	RGD
Cytogenetic Map	6	q32	NCBI

CHGA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	92,922,664 - 92,935,285 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	92,922,630 - 92,935,293 (+)	Ensembl			hg38	GRCh38
GRCh37	14	93,389,495 - 93,401,630 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	92,459,198 - 92,471,391 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	92,459,244 - 92,471,389	NCBI
Celera	14	73,443,584 - 73,455,777 (+)	NCBI		Celera
Cytogenetic Map	14	q32.12	NCBI
HuRef	14	73,571,127 - 73,583,341 (+)	NCBI		HuRef
CHM1_1	14	93,327,694 - 93,339,887 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	87,154,582 - 87,167,278 (+)	NCBI		T2T-CHM13v2.0

Chga
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	102,521,200 - 102,531,286 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	102,521,228 - 102,531,287 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	102,554,941 - 102,565,027 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	102,554,969 - 102,565,028 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	103,793,179 - 103,803,237 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	102,956,019 - 102,966,077 (+)	NCBI		MGSCv36	mm8
Celera	12	103,769,159 - 103,779,238 (+)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	51.66	NCBI

Chga
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	15,092,394 - 15,104,381 (+)	Ensembl
ChiLan1.0	NW_004955438	15,092,267 - 15,104,321 (+)	NCBI	ChiLan1.0	ChiLan1.0

CHGA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	94,080,914 - 94,093,582 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	93,297,419 - 93,310,088 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	73,555,834 - 73,568,547 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	92,895,450 - 92,908,159 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	92,895,450 - 92,908,159 (+)	Ensembl			panPan2	panpan1.1

CHGA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	1,970,966 - 1,973,511 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	1,985,680 - 1,997,123 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	2,017,991 - 2,029,452 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	2,017,971 - 2,029,437 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	1,954,080 - 1,965,378 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	1,904,121 - 1,915,537 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	2,031,347 - 2,042,802 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Chga
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	12,539,821 - 12,551,315 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936733	915,830 - 927,409 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936733	915,700 - 927,220 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHGA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	114,345,305 - 114,358,075 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	114,345,542 - 114,357,799 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	120,954,018 - 120,966,278 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHGA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	70,663,040 - 70,675,827 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	70,663,298 - 70,677,116 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	57,912,590 - 57,924,715 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chga
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	9,404,916 - 9,416,902 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	9,405,121 - 9,416,774 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Chga
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	113,829,207 - 113,840,466 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Chga
86 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	89
Count of miRNA genes:	71
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000010592
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	112483610	147156653	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	114241077	147156653	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	110921244	147156653	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	118366855	147156653	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	122236101	147156653	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	121444670	147156653	Rat

Markers in Region

RH94856

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	121,707,160 - 121,707,308 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	126,445,331 - 126,445,478	NCBI	Rnor6.0
Rnor_5.0	6	135,656,135 - 135,656,282	UniSTS	Rnor5.0
RGSC_v3.4	6	126,832,327 - 126,832,474	UniSTS	RGSC3.4
Celera	6	119,195,914 - 119,196,061	UniSTS
RH 3.4 Map	6	845.4	UniSTS
Cytogenetic Map	6	q32	UniSTS

RH94857

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	121,707,208 - 121,707,342 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	126,445,379 - 126,445,512	NCBI	Rnor6.0
Rnor_5.0	6	135,656,183 - 135,656,316	UniSTS	Rnor5.0
RGSC_v3.4	6	126,832,375 - 126,832,508	UniSTS	RGSC3.4
Celera	6	119,195,962 - 119,196,095	UniSTS
Cytogenetic Map	6	q32	UniSTS

RH135429

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	121,707,104 - 121,707,289 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	126,445,275 - 126,445,459	NCBI	Rnor6.0
Rnor_5.0	6	135,656,079 - 135,656,263	UniSTS	Rnor5.0
RGSC_v3.4	6	126,832,271 - 126,832,455	UniSTS	RGSC3.4
Celera	6	119,195,858 - 119,196,042	UniSTS
RH 3.4 Map	6	844.19	UniSTS
Cytogenetic Map	6	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	35	149	67	66	35	59	35	6	212	119	6	130	34	76	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF145445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB743841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HM443078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HM443079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000090857 ⟹ ENSRNOP00000070296

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	127,460,854 - 127,472,237 (+)	Ensembl
mRatBN7.2 Ensembl	6	121,696,051 - 121,707,398 (+)	Ensembl
Rnor_6.0 Ensembl	6	126,434,226 - 126,445,568 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100782 ⟹ ENSRNOP00000081505

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	121,698,889 - 121,707,398 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114564 ⟹ ENSRNOP00000081394

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	127,463,978 - 127,472,237 (+)	Ensembl
mRatBN7.2 Ensembl	6	121,698,889 - 121,707,398 (+)	Ensembl

RefSeq Acc Id:

NM_021655 ⟹ NP_067687

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	127,460,895 - 127,472,238 (+)	NCBI
mRatBN7.2	6	121,696,051 - 121,707,399 (+)	NCBI
Rnor_6.0	6	126,434,226 - 126,445,569 (+)	NCBI
Rnor_5.0	6	135,645,155 - 135,656,373 (+)	NCBI
Celera	6	119,184,838 - 119,196,152 (+)	RGD

Sequence:

show sequence

GGCTGCTGCTACCGCCACCACCATCACCGCCACTGCCACCACCACCGCTACCGCAGTGCTCCCA
CTGGTGCAGAGCTCCAGTGGTCACAGACCCACTTCCGCCATCCTCCTGCAGCAGCTCGCCCTCT
CTTTCCGCACCGTCCGGCTCGCTATGCGCTCCTCCGCGGCTTTGGCGCTTCTGCTGTGCGCCGG
GCAAGTCTTTGCCCTTCCTGTGAACAGCCCTATGACAAAAGGGGACACTAAGGTGATGAAGTGT
GTCCTGGAGGTCATCTCCGACTCGCTGTCCAAACCCAGCCCCATGCCTGTCAGCCCTGAGTGTC
TGGAGACCCTCCAAGGAGATGAGAGGGTCCTCTCCATCCTTCGACACCAGAATTTGCTGAAGGA
ACTTCAAGACCTGGCGCTTCAAGGTGCCAAGGAGCGGGCCCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAACAACAACAACACAGCAGCTTTGAGGATGAACTCTCGGAAG
TATTTGAGAACCAGAGCCCTGCAGCCAAGCATGGAGACGCAGCATCAGAAGCCCCCTCCAAGGA
CACTGTAGAGAAGAGAGAGGATTCTGACAAGGGGCAACAGGATGCCTTTGAGGGAACCACAGAA
GGACCCAGACCTCAGGCCTTTCCAGAGCCCAAGCAGGAGTCCTCTATGATGGGAAACAGTCAAT
CTCCAGGGGAGGACACAGCCAACAATACCCAATCACCAACCAGCCTCCCCAGCCAGGAGCATGG
GATTCCACAGACCACAGAAGGCAGTGAGAGAGGTCCCAGTGCCCAGCAGCAAGCCAGAAAAGCC
AAGCAAGAGGAGAAAGAGGAAGAGGAGGAGGAGAAAGAGGAAGAGGAGGAGGAGAAAGAGGAGA
AGGCGATCGCCAGAGAGAAGGCTGGGCCTAAAGAAGTCCCCACGGCAGCATCCAGTTCTCACTT
CTATTCAGGCTACAAGAAGATCCAGAAAGATGATGATGGTCAGTCGGAGTCTCAGGCAGTGAAT
GGAAAGACAGGGGCTTCTGAAGCTGTGCCATCTGAAGGGAAGGGGGAGCTGGAGCACTCTCAGC
AGGAGGAAGATGGGGAAGAGGCCATGGCAGGGCCCCCCCAAGGTCTCTTCCCAGGTGGGAAGGG
CCAGGAGCTGGAACGTAAGCAGCAGGAGGAGGAAGAGGAAGAGGAGCGTCTGTCCAGAGAATGG
GAGGACAAGCGATGGAGCAGGATGGACCAGCTGGCCAAGGAGCTGACAGCAGAGAAGCGGCTGG
AGGGGGAAGATGACCCTGACCGGTCCATGAAGCTCTCCTTCCGGGCCCGGGCCTATGGCTTCAG
GGACCCTGGGCCTCAGCTACGCCGGGGCTGGAGGCCATCTTCCAGAGAAGACAGTGTGGAGGCC
CGAGGCGACTTTGAGGAAAAGAAGGAAGAGGAGGGCAGCGCCAACCGCAGAGCAGAGGACCAGG
AGCTAGAGAGCCTGTCAGCCATCGAGGCAGAGCTGGAGAAGGTGGCCCACCAGCTGCAGGCTTT
GCGACGGGGATGAGGCACTGGCTGGTGGGGTCCGGCCATGGCTTCAAGGCCCAACTGCTGCTCA
AGTAGGGAGGCTTCCAGCCTCAGAGCCCAGGTTACCCCTTGCCCCTTCCCTTCTCTTGCTCTCA
GCCCCTGCCCTGGACACTTCTGCAGGGCAGCCCTGAAAGTCAACACAGATTCTTTCTCGGAACA
CAGGCAGCTTTCTAGAAGTTTCTCTTCCACCTTCTAATCCATGGGGCACAACTGCAGTAGTTCT
GATCTTTGGGCGAAAGCCGAGAACTCCTGACTATTAAGATATTCCAGATAAAATTTATTGAAGG
AAGAATAAACCTGCTTTGGGCTCTTCAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067687	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD40652	(Get FASTA)	NCBI Sequence Viewer
	AAH87703	(Get FASTA)	NCBI Sequence Viewer
	AEB41036	(Get FASTA)	NCBI Sequence Viewer
	AEB41037	(Get FASTA)	NCBI Sequence Viewer
	EDL81749	(Get FASTA)	NCBI Sequence Viewer
	EDL81750	(Get FASTA)	NCBI Sequence Viewer
	EDL81751	(Get FASTA)	NCBI Sequence Viewer
	EDL81752	(Get FASTA)	NCBI Sequence Viewer
	EDL81753	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070296
GenBank Protein	P10354	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_067687 ⟸ NM_021655
- Peptide Label:	precursor
- UniProtKB:	P10354 (UniProtKB/Swiss-Prot), Q5PPG5 (UniProtKB/TrEMBL), A6JEK5 (UniProtKB/TrEMBL), F8QYX0 (UniProtKB/TrEMBL), A0A0G2JXJ4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRSSAALALLLCAGQVFALPVNSPMTKGDTKVMKCVLEVISDSLSKPSPMPVSPECLETLQGDE RVLSILRHQNLLKELQDLALQGAKERAQQQQQQQQQQQQQQQQQQQHSSFEDELSEVFENQSPA AKHGDAASEAPSKDTVEKREDSDKGQQDAFEGTTEGPRPQAFPEPKQESSMMGNSQSPGEDTAN NTQSPTSLPSQEHGIPQTTEGSERGPSAQQQARKAKQEEKEEEEEEKEEEEEEKEEKAIAREKA GPKEVPTAASSSHFYSGYKKIQKDDDGQSESQAVNGKTGASEAVPSEGKGELEHSQQEEDGEEA MAGPPQGLFPGGKGQELERKQQEEEEEEERLSREWEDKRWSRMDQLAKELTAEKRLEGEDDPDR SMKLSFRARAYGFRDPGPQLRRGWRPSSREDSVEARGDFEEKKEEEGSANRRAEDQELESLSAI EAELEKVAHQLQALRRG hide sequence

Ensembl Acc Id:

ENSRNOP00000070296 ⟸ ENSRNOT00000090857

Ensembl Acc Id:

ENSRNOP00000081505 ⟸ ENSRNOT00000100782

Ensembl Acc Id:

ENSRNOP00000081394 ⟸ ENSRNOT00000114564

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10354-F1-model_v2	AlphaFold	P10354	1-466	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694784

Promoter ID:

EPDNEW_R5308

Type:

single initiation site

Name:

Chga_1

Description:

chromogranin A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	126,434,227 - 126,434,287	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2338	AgrOrtholog
BioCyc Gene	G2FUF-36446	BioCyc
Ensembl Genes	ENSRNOG00000052549	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000090857	ENTREZGENE
IMAGE_CLONE	IMAGE:7313842	IMAGE-MGC_LOAD
InterPro	Chromogranin_AB	UniProtKB/Swiss-Prot
	Chromogranin_CS	UniProtKB/Swiss-Prot
	Granin	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105435	IMAGE-MGC_LOAD
NCBI Gene	24258	ENTREZGENE
PANTHER	CHROMOGRANIN-A	UniProtKB/Swiss-Prot
	PTHR10583	UniProtKB/Swiss-Prot
Pfam	Granin	UniProtKB/Swiss-Prot
PhenoGen	Chga	PhenoGen
PRINTS	CHROMOGRANIN	UniProtKB/Swiss-Prot
PROSITE	GRANINS_1	UniProtKB/Swiss-Prot
	GRANINS_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000052549	RatGTEx
UniProt	A0A0G2JXJ4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G7X3_RAT	UniProtKB/TrEMBL
	A6JEK5	ENTREZGENE, UniProtKB/TrEMBL
	A6JEK6_RAT	UniProtKB/TrEMBL
	A6JEK7_RAT	UniProtKB/TrEMBL
	A6JEK8_RAT	UniProtKB/TrEMBL
	A6JEK9_RAT	UniProtKB/TrEMBL
	CMGA_RAT	UniProtKB/Swiss-Prot
	F8QYX0	ENTREZGENE, UniProtKB/TrEMBL
	F8QYX1_RAT	UniProtKB/TrEMBL
	P10354	ENTREZGENE
	Q5PPG5	ENTREZGENE
	Q9R1B7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-03-26	Chga	chromogranin A	Chga	chromogranin A (parathyroid secretory protein 1)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-17	Chga	chromogranin A (parathyroid secretory protein 1)	Chga	chromogranin A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-09	Chga	chromogranin A (parathyroid secretory protein 1)	Chga	chromogranin A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Chga	chromogranin A		Chromogranin A, parathyroid secretory protein 1	Name updated	625702	APPROVED
2002-06-10	Chga	Chromogranin A, parathyroid secretory protein 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the secretory granule	724711
gene_pathway	may stimulate protein synthesis machinery by stimulating Pkc and downstream elements like S6k,4E-BP1 and eIF4E	628522
gene_process	counter regulates insulin action by activating a receptor-effector system(G alphaQ/11protin-PLC-beta-PKCclassical); stimulates basal and insulin-mediated protein synthesis; promotes phosphorylation of eIF2E and 4E-BP1 by stimulating S6 kinase activity	628522
gene_process	chromogranin A-derived peptide involved in metabolic activation, regulation of insulin signaling and stimulation of protein synthesis in adipocytes	628522
gene_process	modulates glucose, lipid and protein metabolism in adipocytes	628522

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations