Symbol:
Rab1b
Name:
RAB1B, member RAS oncogene family
RGD ID:
1642882
Description:
Predicted to enable GTP binding activity and GTPase activity. Predicted to be involved in several processes, including autophagosome assembly; endoplasmic reticulum to Golgi vesicle-mediated transport; and regulation of autophagosome assembly. Is active in synapse. Orthologous to several human genes including RAB1B (RAB1B, member RAS oncogene family); INTERACTS WITH acetamide; acrylamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC105830; RAB1B-like, member RAS oncogene family; Rab1bl; ras-related protein Rab-1B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAB1B (RAB1B, member RAS oncogene family) RGD
RGD
Mus musculus (house mouse):
Rab1b (RAB1B, member RAS oncogene family) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Rab1b (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAB1B (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAB1B (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rab1b (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAB1B (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAB1B (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rab1b (RAB1B, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RAB1C (RAB1C, member RAS oncogene family (pseudogene)) HGNC
Panther
Alliance orthologs 3
Homo sapiens (human):
RAB1B (RAB1B, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Rab1b (RAB1B, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rab1bb (RAB1B, member RAS oncogene family b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
rab1ba (zRAB1B, member RAS oncogene family a)
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
rab-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rab1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YPT1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Related Pseudogenes:
Rab1b-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 211,835,133 - 211,843,408 (-) NCBI GRCr8 mRatBN7.2 1 202,405,759 - 202,413,850 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 50,857,916 - 50,859,762 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 1 202,405,759 - 202,413,868 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 210,758,818 - 210,766,910 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 217,851,200 - 217,859,291 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 210,542,234 - 210,550,325 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 220,483,529 - 220,491,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 220,480,834 - 220,491,469 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 227,414,583 - 227,422,523 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 207,720,833 - 207,727,458 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 199,945,209 - 199,953,183 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rab1b Rat (1->4)-beta-D-glucan multiple interactions ISO Rab1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RAB1B mRNA CTD PMID:36331819 Rab1b Rat 1,2-dimethylhydrazine multiple interactions ISO Rab1b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RAB1B mRNA CTD PMID:22206623 Rab1b Rat 17beta-estradiol multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of RAB1B mRNA CTD PMID:20823114 Rab1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rab1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RAB1B mRNA CTD PMID:21570461 and PMID:24680724 Rab1b Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rab1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to RAB1B promoter] CTD PMID:19654925 Rab1b Rat 2,6-dimethoxyphenol multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of RAB1B protein CTD PMID:38598786 Rab1b Rat 4,4'-sulfonyldiphenol increases expression ISO Rab1b (Mus musculus) 6480464 bisphenol S results in increased expression of RAB1B mRNA CTD PMID:39298647 Rab1b Rat 4,4'-sulfonyldiphenol affects methylation ISO Rab1b (Mus musculus) 6480464 bisphenol S affects the methylation of RAB1B gene CTD PMID:31683443 Rab1b Rat 4,4'-sulfonyldiphenol decreases methylation ISO Rab1b (Mus musculus) 6480464 bisphenol S results in decreased methylation of RAB1B exon and bisphenol S results in decreased methylation of RAB1B promoter CTD PMID:33297965 Rab1b Rat 5-azacytidine increases expression ISO RAB1B (Homo sapiens) 6480464 Azacitidine results in increased expression of RAB1B mRNA CTD PMID:20823114 Rab1b Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of RAB1B mRNA CTD PMID:31881176 Rab1b Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RAB1B mRNA CTD PMID:28959563 Rab1b Rat actinomycin D multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RAB1B protein CTD PMID:38460933 Rab1b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RAB1B mRNA CTD PMID:16483693 Rab1b Rat arsenite(3-) multiple interactions ISO RAB1B (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of RAB1B mRNA CTD PMID:23487506 Rab1b Rat benzo[a]pyrene decreases expression ISO RAB1B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RAB1B mRNA CTD PMID:20106945 Rab1b Rat benzo[a]pyrene multiple interactions ISO Rab1b (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to RAB1B promoter] CTD PMID:19654925 Rab1b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RAB1B mRNA CTD PMID:25181051 Rab1b Rat bisphenol A increases expression ISO Rab1b (Mus musculus) 6480464 bisphenol A results in increased expression of RAB1B mRNA CTD PMID:32156529 Rab1b Rat bisphenol A increases expression ISO RAB1B (Homo sapiens) 6480464 bisphenol A results in increased expression of RAB1B protein CTD PMID:34186270 Rab1b Rat bisphenol AF increases expression ISO RAB1B (Homo sapiens) 6480464 bisphenol AF results in increased expression of RAB1B protein CTD PMID:34186270 Rab1b Rat Bisphenol B increases expression ISO RAB1B (Homo sapiens) 6480464 bisphenol B results in increased expression of RAB1B protein CTD PMID:34186270 Rab1b Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of RAB1B protein CTD PMID:25933445 Rab1b Rat bucladesine multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of RAB1B mRNA CTD PMID:20823114 Rab1b Rat caffeine decreases phosphorylation ISO RAB1B (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of RAB1B protein CTD PMID:35688186 Rab1b Rat carbon nanotube increases expression ISO Rab1b (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of RAB1B protein CTD PMID:34864091 Rab1b Rat chlorpyrifos increases expression ISO Rab1b (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RAB1B mRNA CTD PMID:37019170 Rab1b Rat cobalt dichloride decreases expression ISO RAB1B (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of RAB1B mRNA CTD PMID:19376846 Rab1b Rat CU-O LINKAGE decreases expression ISO RAB1B (Homo sapiens) 6480464 cupric oxide results in decreased expression of RAB1B protein CTD PMID:25470785 Rab1b Rat cyclosporin A decreases expression ISO RAB1B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RAB1B mRNA CTD PMID:20106945 Rab1b Rat dextran sulfate multiple interactions ISO Rab1b (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of RAB1B protein] and evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of RAB1B protein] CTD PMID:32272095 and PMID:35362542 Rab1b Rat dextran sulfate increases expression ISO Rab1b (Mus musculus) 6480464 Dextran Sulfate results in increased expression of RAB1B protein CTD PMID:35362542 Rab1b Rat dextran sulfate decreases expression ISO Rab1b (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of RAB1B protein CTD PMID:32272095 Rab1b Rat Dibutyl phosphate affects expression ISO RAB1B (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RAB1B mRNA CTD PMID:37042841 Rab1b Rat dibutyl phthalate increases expression ISO Rab1b (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RAB1B protein CTD PMID:34864091 Rab1b Rat diuron decreases expression ISO RAB1B (Homo sapiens) 6480464 Diuron results in decreased expression of RAB1B mRNA CTD PMID:35967413 Rab1b Rat doxorubicin decreases expression ISO RAB1B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RAB1B mRNA CTD PMID:29803840 Rab1b Rat ethanol affects expression EXP 6480464 Ethanol affects the expression of RAB1B mRNA CTD PMID:11772933 Rab1b Rat Evodiamine multiple interactions ISO Rab1b (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of RAB1B protein] CTD PMID:35362542 Rab1b Rat fenthion increases expression ISO Rab1b (Mus musculus) 6480464 Fenthion results in increased expression of RAB1B mRNA CTD PMID:34813904 Rab1b Rat fluoranthene multiple interactions ISO Rab1b (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of RAB1B mRNA CTD PMID:28329830 Rab1b Rat folic acid decreases expression ISO RAB1B (Homo sapiens) 6480464 Folic Acid results in decreased expression of RAB1B mRNA CTD PMID:21867686 Rab1b Rat folic acid multiple interactions ISO Rab1b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RAB1B mRNA CTD PMID:22206623 Rab1b Rat furan increases methylation EXP 6480464 furan results in increased methylation of RAB1B gene CTD PMID:22079235 Rab1b Rat furfural multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RAB1B protein CTD PMID:38598786 Rab1b Rat homocysteine multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Methionine deficiency co-treated with Homocysteine] affects the expression of RAB1B protein CTD PMID:17116298 Rab1b Rat hydrogen cyanide decreases expression ISO Rab1b (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of RAB1B mRNA CTD PMID:33914522 Rab1b Rat inulin multiple interactions ISO Rab1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of RAB1B mRNA CTD PMID:36331819 Rab1b Rat ivermectin decreases expression ISO RAB1B (Homo sapiens) 6480464 Ivermectin results in decreased expression of RAB1B protein CTD PMID:32959892 Rab1b Rat L-methionine multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Methionine deficiency co-treated with Homocysteine] affects the expression of RAB1B protein CTD PMID:17116298 Rab1b Rat medroxyprogesterone acetate multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of RAB1B mRNA CTD PMID:20823114 Rab1b Rat nitrates multiple interactions ISO Rab1b (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RAB1B mRNA CTD PMID:35964746 Rab1b Rat Nutlin-3 multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RAB1B protein CTD PMID:38460933 Rab1b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rab1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RAB1B mRNA more ... CTD PMID:36331819 Rab1b Rat perfluorooctanoic acid decreases expression ISO RAB1B (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of RAB1B protein CTD PMID:26879310 Rab1b Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of RAB1B mRNA CTD PMID:15215175 Rab1b Rat pirinixic acid increases expression ISO Rab1b (Mus musculus) 6480464 pirinixic acid results in increased expression of RAB1B mRNA CTD PMID:18301758 Rab1b Rat potassium cyanide increases expression ISO Rab1b (Mus musculus) 6480464 Potassium Cyanide results in increased expression of RAB1B mRNA CTD PMID:33914522 Rab1b Rat quercetin increases expression ISO RAB1B (Homo sapiens) 6480464 Quercetin results in increased expression of RAB1B mRNA CTD PMID:21632981 Rab1b Rat silicon dioxide decreases methylation ISO RAB1B (Homo sapiens) 6480464 Silicon Dioxide results in decreased methylation of RAB1B gene and Silicon Dioxide results in decreased methylation of RAB1B promoter CTD PMID:34973136 Rab1b Rat sodium arsenite multiple interactions ISO RAB1B (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of RAB1B mRNA CTD PMID:23487506 Rab1b Rat sodium arsenite increases expression ISO RAB1B (Homo sapiens) 6480464 sodium arsenite results in increased expression of RAB1B mRNA CTD PMID:34032870 Rab1b Rat sodium arsenite decreases expression ISO RAB1B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RAB1B mRNA CTD PMID:38568856 Rab1b Rat sodium chloride multiple interactions ISO RAB1B (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RAB1B protein more ... CTD PMID:38598786 Rab1b Rat sunitinib decreases expression ISO RAB1B (Homo sapiens) 6480464 Sunitinib results in decreased expression of RAB1B mRNA CTD PMID:31533062 Rab1b Rat temozolomide decreases expression ISO RAB1B (Homo sapiens) 6480464 Temozolomide results in decreased expression of RAB1B mRNA CTD PMID:31758290 Rab1b Rat thiram decreases expression ISO RAB1B (Homo sapiens) 6480464 Thiram results in decreased expression of RAB1B mRNA CTD PMID:38568856 Rab1b Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of RAB1B mRNA CTD PMID:33387578 Rab1b Rat triphenyl phosphate affects expression ISO RAB1B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RAB1B mRNA CTD PMID:37042841 Rab1b Rat valproic acid increases methylation ISO RAB1B (Homo sapiens) 6480464 Valproic Acid results in increased methylation of RAB1B gene CTD PMID:29154799 Rab1b Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of RAB1B mRNA CTD PMID:19015723
Rab1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 211,835,133 - 211,843,408 (-) NCBI GRCr8 mRatBN7.2 1 202,405,759 - 202,413,850 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 50,857,916 - 50,859,762 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 1 202,405,759 - 202,413,868 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 210,758,818 - 210,766,910 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 217,851,200 - 217,859,291 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 210,542,234 - 210,550,325 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 220,483,529 - 220,491,469 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 220,480,834 - 220,491,469 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 227,414,583 - 227,422,523 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 207,720,833 - 207,727,458 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 199,945,209 - 199,953,183 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
RAB1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 66,268,639 - 66,277,492 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 66,268,590 - 66,277,492 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 66,036,110 - 66,044,963 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 65,792,632 - 65,801,539 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 65,792,680 - 65,801,539 NCBI Cytogenetic Map 11 q13.2 NCBI HuRef 11 62,361,564 - 62,370,459 (+) NCBI HuRef CHM1_1 11 65,920,155 - 65,929,064 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 66,262,312 - 66,271,155 (+) NCBI T2T-CHM13v2.0
Rab1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 5,149,235 - 5,157,024 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 5,149,233 - 5,157,100 (-) Ensembl GRCm39 Ensembl GRCm38 19 5,099,207 - 5,106,996 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 5,099,205 - 5,107,072 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 5,099,207 - 5,106,996 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 5,099,207 - 5,106,996 (-) NCBI MGSCv36 mm8 Celera 19 4,968,413 - 4,976,202 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 4.25 NCBI
Rab1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 19,039,632 - 19,047,088 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 19,039,741 - 19,047,088 (-) NCBI ChiLan1.0 ChiLan1.0
RAB1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 67,502,340 - 67,511,293 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 68,545,212 - 68,554,168 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 61,634,017 - 61,642,945 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 64,959,957 - 64,968,843 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 64,959,957 - 64,968,843 (+) Ensembl panpan1.1 panPan2
RAB1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 51,026,975 - 51,034,356 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 51,028,013 - 51,034,473 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 49,635,724 - 49,643,112 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 52,065,422 - 52,072,793 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 52,065,422 - 52,072,757 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 51,165,421 - 51,172,793 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 50,739,588 - 50,746,974 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 51,529,728 - 51,537,099 (-) NCBI UU_Cfam_GSD_1.0
Rab1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 6,874,909 - 6,881,904 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 3,317,258 - 3,324,213 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 3,317,258 - 3,324,208 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAB1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 6,102,354 - 6,116,221 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 6,110,438 - 6,116,443 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 5,185,936 - 5,188,256 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAB1B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 7,989,521 - 7,998,371 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 7,989,101 - 7,998,105 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 105,271,045 - 105,280,234 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rab1b
.
Predicted Target Of
Count of predictions: 63 Count of miRNA genes: 58 Interacting mature miRNAs: 62 Transcripts: ENSRNOT00000042711 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH129825
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 202,414,594 - 202,414,778 (+) MAPPER mRatBN7.2 Rnor_6.0 1 220,492,214 - 220,492,397 NCBI Rnor6.0 Rnor_5.0 1 227,423,268 - 227,423,451 UniSTS Rnor5.0 RGSC_v3.4 1 207,728,203 - 207,728,386 UniSTS RGSC3.4 Celera 1 199,953,908 - 199,954,091 UniSTS RH 3.4 Map 1 1555.9 UniSTS Cytogenetic Map 1 q43 UniSTS
RH141285
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 50,859,529 - 50,859,709 (-) MAPPER mRatBN7.2 mRatBN7.2 1 202,405,783 - 202,405,963 (+) MAPPER mRatBN7.2 Rnor_6.0 1 220,483,554 - 220,483,733 NCBI Rnor6.0 Rnor_6.0 1 220,480,853 - 220,481,032 NCBI Rnor6.0 Rnor_5.0 1 227,411,907 - 227,412,086 UniSTS Rnor5.0 Rnor_5.0 1 227,414,608 - 227,414,787 UniSTS Rnor5.0 RGSC_v3.4 X 73,109,636 - 73,109,815 UniSTS RGSC3.4 Celera 1 199,945,234 - 199,945,413 UniSTS RH 3.4 Map X 631.41 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000042711 ⟹ ENSRNOP00000067788
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 50,857,916 - 50,859,762 (+) Ensembl Rnor_6.0 Ensembl 1 220,480,834 - 220,491,469 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098326 ⟹ ENSRNOP00000093740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,407,071 - 202,413,868 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099092 ⟹ ENSRNOP00000084341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,405,759 - 202,413,570 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100410 ⟹ ENSRNOP00000097890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,405,776 - 202,413,868 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100754 ⟹ ENSRNOP00000091504
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,405,759 - 202,413,868 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101552 ⟹ ENSRNOP00000086550
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,405,761 - 202,413,837 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105874 ⟹ ENSRNOP00000087989
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,405,759 - 202,412,737 (-) Ensembl
RefSeq Acc Id:
NM_001109979 ⟹ NP_001103449
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,835,133 - 211,843,222 (-) NCBI mRatBN7.2 1 202,405,759 - 202,413,850 (-) NCBI Rnor_6.0 1 220,483,529 - 220,491,469 (-) NCBI Rnor_5.0 1 227,414,583 - 227,422,523 (-) NCBI RGSC_v3.4 1 207,720,833 - 207,727,458 (-) RGD
Sequence:
CGGCCACCATCTTGGAACGGGAGGCGGAGCAGAGCCGACTGGGAGCGACCGAGCGGGCCACCGCTGCCGCCATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGGTGACTCGGGCGTG
hide sequence
RefSeq Acc Id:
XM_063280833 ⟹ XP_063136903
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,836,662 - 211,843,406 (-) NCBI
RefSeq Acc Id:
XR_010063214
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,836,662 - 211,843,408 (-) NCBI
RefSeq Acc Id:
NP_001103449 ⟸ NM_001109979
- UniProtKB:
P10536 (UniProtKB/Swiss-Prot), G3V6H0 (UniProtKB/TrEMBL), A6HZ30 (UniProtKB/TrEMBL)
- Sequence:
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTK
hide sequence
Ensembl Acc Id:
ENSRNOP00000067788 ⟸ ENSRNOT00000042711
Ensembl Acc Id:
ENSRNOP00000097890 ⟸ ENSRNOT00000100410
Ensembl Acc Id:
ENSRNOP00000091504 ⟸ ENSRNOT00000100754
Ensembl Acc Id:
ENSRNOP00000084341 ⟸ ENSRNOT00000099092
Ensembl Acc Id:
ENSRNOP00000087989 ⟸ ENSRNOT00000105874
Ensembl Acc Id:
ENSRNOP00000086550 ⟸ ENSRNOT00000101552
Ensembl Acc Id:
ENSRNOP00000093740 ⟸ ENSRNOT00000098326
RefSeq Acc Id:
XP_063136903 ⟸ XM_063280833
- Peptide Label:
isoform X1
RGD ID: 13690643 Promoter ID: EPDNEW_R1167 Type: initiation region Name: LOC100363782_1 Description: RAB1B, member RAS oncogene family-like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 220,491,439 - 220,491,499 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-11-24
Rab1b
Rab1bb
RAB1B, member RAS oncogene family
Symbol and Name updated
1299863 APPROVED
2008-11-24
Rab1bb
RAB1B, member RAS oncogene family
Rab1bl
RAB1B-like, member RAS oncogene family
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-17
Rab1bl
RAB1B-like, member RAS oncogene family
Rab1b
RAB1B, member RAS oncogene family
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2007-10-19
Rab1b
RAB1B, member RAS oncogene family
Symbol and Name status set to provisional
70820 PROVISIONAL
