Symbol:
Meis1
Name:
Meis homeobox 1
RGD ID:
1585482
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Involved in cell growth involved in cardiac muscle cell development. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Orthologous to human MEIS1 (Meis homeobox 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
homeobox protein Meis1; LOC108352805; LOC686117; Meis1, myeloid ecotropic viral integration site 1 homolog; similar to myeloid ecotropic viral integration site 1; uncharacterized LOC108352805
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MEIS1 (Meis homeobox 1)
HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Meis1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Meis1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MEIS1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MEIS1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Meis1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MEIS1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MEIS1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Meis1 (Meis homeobox 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MEIS2 (Meis homeobox 2)
HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
MEIS1 (Meis homeobox 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Meis1 (Meis homeobox 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
meis1b (Meis homeobox 1 b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
meis1a (Meis homeobox 1 a)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
CUP9
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
hth
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
unc-62
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TOS8
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
meis1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 97,356,949 - 97,499,646 (-) NCBI GRCr8 mRatBN7.2 14 93,155,426 - 93,294,373 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 93,155,419 - 93,294,265 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 97,471,782 - 97,610,378 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 98,716,059 - 98,854,667 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 95,181,092 - 95,319,673 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 103,182,178 - 103,321,809 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 103,181,281 - 103,321,270 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 102,927,220 - 103,064,633 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 99,693,567 - 99,832,273 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 92,182,045 - 92,319,516 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Meis1 Rat (R)-adrenaline decreases expression ISO Meis1 (Mus musculus) 6480464 Epinephrine results in decreased expression of MEIS1 protein CTD PMID:31520687 Meis1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of MEIS1 mRNA CTD PMID:26496021 Meis1 Rat 17beta-estradiol increases expression ISO MEIS1 (Homo sapiens) 6480464 Estradiol results in increased expression of MEIS1 mRNA CTD PMID:31614463 Meis1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO MEIS1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of MEIS1 mRNA CTD PMID:29581250 Meis1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl decreases expression ISO MEIS1 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Meis1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Meis1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MEIS1 mRNA CTD PMID:24058054 Meis1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MEIS1 mRNA CTD PMID:34747641 Meis1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Meis1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MEIS1 mRNA CTD PMID:21570461 Meis1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MEIS1 mRNA CTD PMID:21215274 more ... Meis1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Meis1 Rat 2-hydroxypropanoic acid increases expression ISO MEIS1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MEIS1 mRNA CTD PMID:30851411 Meis1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MEIS1 mRNA CTD PMID:28628672 Meis1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO MEIS1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of MEIS1 gene CTD PMID:31601247 Meis1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Meis1 (Mus musculus) 6480464 Fenretinide results in decreased expression of MEIS1 mRNA CTD PMID:28973697 Meis1 Rat 4-hydroxyphenyl retinamide increases expression ISO Meis1 (Mus musculus) 6480464 Fenretinide results in increased expression of MEIS1 mRNA CTD PMID:28973697 Meis1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MEIS1 mRNA CTD PMID:24780913 Meis1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MEIS1 mRNA CTD PMID:30047161 Meis1 Rat 9-cis-retinoic acid increases expression ISO MEIS1 (Homo sapiens) 6480464 Alitretinoin results in increased expression of MEIS1 mRNA CTD PMID:17034753 Meis1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of MEIS1 mRNA CTD PMID:28959563 Meis1 Rat acrylamide decreases expression ISO MEIS1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of MEIS1 mRNA CTD PMID:32763439 Meis1 Rat aflatoxin B1 decreases expression ISO MEIS1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MEIS1 mRNA CTD PMID:21641981 Meis1 Rat aflatoxin B1 decreases methylation ISO MEIS1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MEIS1 gene CTD PMID:27153756 Meis1 Rat all-trans-4-oxoretinoic acid increases expression ISO MEIS1 (Homo sapiens) 6480464 4-oxoretinoic acid results in increased expression of MEIS1 mRNA CTD PMID:17034753 Meis1 Rat all-trans-4-oxoretinol increases expression ISO MEIS1 (Homo sapiens) 6480464 4-oxoretinol results in increased expression of MEIS1 mRNA CTD PMID:17034753 Meis1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of MEIS1 mRNA CTD PMID:20488242 Meis1 Rat all-trans-retinoic acid increases expression ISO MEIS1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MEIS1 mRNA CTD PMID:17034753 more ... Meis1 Rat all-trans-retinol increases expression ISO MEIS1 (Homo sapiens) 6480464 Vitamin A results in increased expression of MEIS1 mRNA CTD PMID:17034753 Meis1 Rat all-trans-retinol multiple interactions ISO Meis1 (Mus musculus) 6480464 [RARA gene mutant form co-treated with Vitamin A] results in increased expression of MEIS1 mRNA and RARG gene mutant form inhibits the reaction [[RARA gene mutant form co-treated with Vitamin A] results in increased expression of MEIS1 mRNA] CTD PMID:16397886 Meis1 Rat aristolochic acid A decreases expression ISO MEIS1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MEIS1 mRNA CTD PMID:33212167 Meis1 Rat arsane affects methylation ISO MEIS1 (Homo sapiens) 6480464 Arsenic affects the methylation of MEIS1 gene CTD PMID:25304211 Meis1 Rat arsane multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MEIS1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MEIS1 mRNA CTD PMID:39836092 Meis1 Rat arsenic atom affects methylation ISO MEIS1 (Homo sapiens) 6480464 Arsenic affects the methylation of MEIS1 gene CTD PMID:25304211 Meis1 Rat arsenic atom multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MEIS1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MEIS1 mRNA CTD PMID:39836092 Meis1 Rat arsenite(3-) multiple interactions ISO MEIS1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MEIS1 mRNA] CTD PMID:32406909 Meis1 Rat benzene decreases expression ISO MEIS1 (Homo sapiens) 6480464 Benzene results in decreased expression of MEIS1 mRNA CTD PMID:19162166 Meis1 Rat benzo[a]pyrene decreases expression ISO Meis1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MEIS1 mRNA CTD PMID:21569818 Meis1 Rat benzo[a]pyrene affects methylation ISO Meis1 (Mus musculus) 6480464 Benzo(a)pyrene affects the methylation of MEIS1 intron CTD PMID:27901495 Meis1 Rat benzo[a]pyrene decreases expression ISO MEIS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MEIS1 mRNA CTD PMID:26238291 Meis1 Rat benzo[a]pyrene diol epoxide I affects expression ISO MEIS1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Meis1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO MEIS1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Meis1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of MEIS1 mRNA CTD PMID:26496021 Meis1 Rat bisphenol A affects methylation ISO MEIS1 (Homo sapiens) 6480464 bisphenol A affects the methylation of MEIS1 gene CTD PMID:31601247 Meis1 Rat bisphenol A multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of MEIS1 gene CTD PMID:31601247 Meis1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MEIS1 gene CTD PMID:28505145 Meis1 Rat bisphenol A affects methylation ISO Meis1 (Mus musculus) 6480464 bisphenol A affects the methylation of MEIS1 promoter CTD PMID:27334623 Meis1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MEIS1 mRNA CTD PMID:25181051 Meis1 Rat bisphenol F multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MEIS1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MEIS1 mRNA CTD PMID:28628672 and PMID:31601247 Meis1 Rat cadmium atom multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MEIS1 mRNA CTD PMID:35301059 Meis1 Rat cadmium dichloride multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MEIS1 mRNA CTD PMID:35301059 Meis1 Rat cantharidin decreases expression ISO Meis1 (Mus musculus) 6480464 Cantharidin results in decreased expression of MEIS1 mRNA CTD PMID:36907384 Meis1 Rat carbon nanotube decreases expression ISO Meis1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Meis1 Rat chloroethene increases expression ISO Meis1 (Mus musculus) 6480464 Vinyl Chloride results in increased expression of MEIS1 mRNA CTD PMID:18579281 Meis1 Rat choline multiple interactions ISO Meis1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of MEIS1 gene and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MEIS1 mRNA CTD PMID:20938992 Meis1 Rat cisplatin multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of MEIS1 mRNA CTD PMID:27392435 Meis1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of MEIS1 mRNA CTD PMID:24386269 Meis1 Rat crocidolite asbestos decreases expression ISO Meis1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of MEIS1 mRNA CTD PMID:19446018 Meis1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MEIS1 mRNA CTD PMID:26577399 Meis1 Rat cyclosporin A decreases expression ISO MEIS1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MEIS1 mRNA CTD PMID:20106945 and PMID:25562108 Meis1 Rat cytarabine increases expression ISO MEIS1 (Homo sapiens) 6480464 Cytarabine results in increased expression of MEIS1 mRNA CTD PMID:21198554 Meis1 Rat dexamethasone multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MEIS1 mRNA CTD PMID:28628672 Meis1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MEIS1 mRNA CTD PMID:21266533 Meis1 Rat disodium selenite multiple interactions ISO Meis1 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of MEIS1 mRNA CTD PMID:23274088 Meis1 Rat dorsomorphin multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Meis1 Rat doxorubicin decreases expression ISO MEIS1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MEIS1 mRNA CTD PMID:29803840 Meis1 Rat entinostat decreases expression ISO MEIS1 (Homo sapiens) 6480464 entinostat results in decreased expression of MEIS1 mRNA CTD PMID:26272509 Meis1 Rat entinostat multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MEIS1 mRNA CTD PMID:27188386 Meis1 Rat enzyme inhibitor multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MEIS1 protein CTD PMID:23301498 Meis1 Rat Evodiamine decreases expression ISO MEIS1 (Homo sapiens) 6480464 evodiamine results in decreased expression of MEIS1 mRNA CTD PMID:32057900 Meis1 Rat folic acid multiple interactions ISO Meis1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of MEIS1 gene and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MEIS1 mRNA CTD PMID:20938992 Meis1 Rat formaldehyde decreases expression ISO MEIS1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MEIS1 mRNA CTD PMID:20655997 Meis1 Rat FR900359 increases phosphorylation ISO MEIS1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of MEIS1 protein CTD PMID:37730182 Meis1 Rat fulvestrant multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of MEIS1 gene and [bisphenol F co-treated with Fulvestrant] results in increased methylation of MEIS1 gene CTD PMID:31601247 Meis1 Rat indometacin multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MEIS1 mRNA CTD PMID:28628672 Meis1 Rat L-methionine multiple interactions ISO Meis1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of MEIS1 gene and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of MEIS1 mRNA CTD PMID:20938992 Meis1 Rat Licochalcone B decreases expression ISO MEIS1 (Homo sapiens) 6480464 licochalcone B results in decreased expression of MEIS1 mRNA CTD PMID:33647349 Meis1 Rat malathion decreases expression ISO MEIS1 (Homo sapiens) 6480464 Malathion results in decreased expression of MEIS1 mRNA CTD PMID:37047231 Meis1 Rat manganese atom multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MEIS1 mRNA CTD PMID:39836092 Meis1 Rat manganese(0) multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MEIS1 mRNA CTD PMID:39836092 Meis1 Rat manganese(II) chloride multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MEIS1 mRNA CTD PMID:39836092 Meis1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MEIS1 mRNA CTD PMID:30047161 Meis1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of MEIS1 gene CTD PMID:35440735 Meis1 Rat methylmercury chloride decreases expression ISO MEIS1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MEIS1 mRNA CTD PMID:28001369 Meis1 Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of MEIS1 mRNA CTD PMID:25972201 Meis1 Rat nickel atom decreases expression ISO MEIS1 (Homo sapiens) 6480464 Nickel results in decreased expression of MEIS1 mRNA CTD PMID:24768652 Meis1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MEIS1 mRNA CTD PMID:25729387 Meis1 Rat ozone multiple interactions ISO Meis1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MEIS1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MEIS1 mRNA CTD PMID:34911549 Meis1 Rat paracetamol decreases expression ISO MEIS1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MEIS1 mRNA CTD PMID:26690555 Meis1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MEIS1 mRNA CTD PMID:33387578 Meis1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO MEIS1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of MEIS1 mRNA CTD PMID:27153767 Meis1 Rat potassium chromate decreases expression ISO MEIS1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MEIS1 mRNA CTD PMID:22714537 Meis1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MEIS1 mRNA CTD PMID:30047161 Meis1 Rat Ptaquiloside multiple interactions ISO Meis1 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of MEIS1 mRNA CTD PMID:23274088 Meis1 Rat quercetin decreases expression ISO MEIS1 (Homo sapiens) 6480464 Quercetin results in decreased expression of MEIS1 mRNA CTD PMID:21632981 Meis1 Rat rac-lactic acid increases expression ISO MEIS1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MEIS1 mRNA CTD PMID:30851411 Meis1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO MEIS1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of MEIS1 mRNA CTD PMID:33725128 Meis1 Rat SB 431542 multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Meis1 Rat sodium arsenite multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MEIS1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MEIS1 mRNA CTD PMID:39836092 Meis1 Rat sodium arsenite decreases expression ISO Meis1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MEIS1 mRNA CTD PMID:36209798 Meis1 Rat sotorasib multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of MEIS1 mRNA CTD PMID:36139627 Meis1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MEIS1 mRNA CTD PMID:30047161 Meis1 Rat temozolomide increases expression ISO MEIS1 (Homo sapiens) 6480464 Temozolomide results in increased expression of MEIS1 mRNA CTD PMID:31758290 Meis1 Rat thapsigargin decreases expression ISO MEIS1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of MEIS1 mRNA CTD PMID:22378314 Meis1 Rat titanium dioxide decreases methylation ISO Meis1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MEIS1 enhancer CTD PMID:35295148 Meis1 Rat titanium dioxide increases methylation ISO MEIS1 (Homo sapiens) 6480464 titanium dioxide results in increased methylation of MEIS1 3' UTR more ... CTD PMID:34973136 Meis1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MEIS1 mRNA CTD PMID:25729387 Meis1 Rat trametinib multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of MEIS1 mRNA CTD PMID:36139627 Meis1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of MEIS1 mRNA CTD PMID:33387578 Meis1 Rat trichostatin A increases expression ISO MEIS1 (Homo sapiens) 6480464 trichostatin A results in increased expression of MEIS1 mRNA CTD PMID:24935251 Meis1 Rat trichostatin A multiple interactions ISO MEIS1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MEIS1 mRNA CTD PMID:27188386 Meis1 Rat trichostatin A decreases expression ISO MEIS1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of MEIS1 mRNA CTD PMID:24935251 and PMID:26272509 Meis1 Rat triphenyl phosphate affects expression ISO MEIS1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MEIS1 mRNA CTD PMID:37042841 Meis1 Rat triptonide decreases expression ISO Meis1 (Mus musculus) 6480464 triptonide results in decreased expression of MEIS1 mRNA CTD PMID:33045310 Meis1 Rat tunicamycin decreases expression ISO MEIS1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of MEIS1 mRNA CTD PMID:22378314 Meis1 Rat urethane increases expression ISO MEIS1 (Homo sapiens) 6480464 Urethane results in increased expression of MEIS1 mRNA CTD PMID:28818685 Meis1 Rat valproic acid increases expression ISO MEIS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MEIS1 mRNA CTD PMID:23179753 and PMID:24383497 Meis1 Rat valproic acid affects expression ISO MEIS1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MEIS1 mRNA CTD PMID:25979313 Meis1 Rat valproic acid increases methylation ISO MEIS1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MEIS1 gene CTD PMID:29154799
(R)-adrenaline (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-4-oxoretinol (ISO) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cantharidin (ISO) carbon nanotube (ISO) chloroethene (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) enzyme inhibitor (ISO) Evodiamine (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) indometacin (ISO) L-methionine (ISO) Licochalcone B (ISO) malathion (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (ISO) mifepristone (EXP) nickel atom (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) Ptaquiloside (ISO) quercetin (ISO) rac-lactic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sotorasib (ISO) sulfadimethoxine (EXP) temozolomide (ISO) thapsigargin (ISO) titanium dioxide (ISO) topotecan (EXP) trametinib (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO)
Biological Process
angiogenesis (IBA,IEA,ISO) animal organ morphogenesis (IBA) blood vessel morphogenesis (IEA,ISO) brain development (IBA) cell growth involved in cardiac muscle cell development (IMP) definitive hemopoiesis (IEA,ISO) embryonic pattern specification (IBA) eye development (IBA) hemopoiesis (IBA,IEA,ISO) lens morphogenesis in camera-type eye (IEA,ISO) locomotory behavior (IEA,ISO) megakaryocyte development (IEA,ISO) negative regulation of myeloid cell differentiation (IEA,ISO) negative regulation of neuron differentiation (IEA,ISO) positive regulation of cell population proliferation (IBA) positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO) regulation of DNA-templated transcription (IEA,ISO)
Meis1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 97,356,949 - 97,499,646 (-) NCBI GRCr8 mRatBN7.2 14 93,155,426 - 93,294,373 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 93,155,419 - 93,294,265 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 97,471,782 - 97,610,378 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 98,716,059 - 98,854,667 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 95,181,092 - 95,319,673 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 103,182,178 - 103,321,809 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 103,181,281 - 103,321,270 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 102,927,220 - 103,064,633 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 99,693,567 - 99,832,273 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 92,182,045 - 92,319,516 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
MEIS1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 66,435,125 - 66,573,869 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 66,433,452 - 66,573,869 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 66,662,257 - 66,801,001 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 66,516,036 - 66,653,395 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 66,574,182 - 66,711,541 NCBI Celera 2 66,510,942 - 66,648,316 (+) NCBI Celera Cytogenetic Map 2 p14 NCBI HuRef 2 66,397,888 - 66,535,182 (+) NCBI HuRef CHM1_1 2 66,593,726 - 66,731,071 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 66,444,205 - 66,582,943 (+) NCBI T2T-CHM13v2.0
Meis1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 18,830,428 - 18,968,992 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 18,829,817 - 18,968,985 (-) Ensembl GRCm39 Ensembl GRCm38 11 18,880,428 - 19,019,651 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 18,879,817 - 19,018,985 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 18,780,431 - 18,918,683 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 18,780,431 - 18,918,683 (-) NCBI MGSCv36 mm8 Celera 11 21,034,144 - 21,171,771 (-) NCBI Celera Cytogenetic Map 11 A3.1 NCBI cM Map 11 11.11 NCBI
Meis1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 18,058,004 - 18,190,453 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 18,060,499 - 18,190,425 (-) NCBI ChiLan1.0 ChiLan1.0
MEIS1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 59,830,340 - 59,968,706 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 59,833,083 - 59,972,676 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 66,494,934 - 66,633,295 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 67,615,941 - 67,752,958 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 67,615,941 - 67,752,958 (+) Ensembl panpan1.1 panPan2
MEIS1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 65,765,498 - 65,898,714 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 65,683,560 - 65,897,573 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 65,654,860 - 65,820,227 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 66,778,156 - 66,943,912 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 66,778,687 - 66,927,290 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 66,456,570 - 66,622,034 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 66,764,024 - 66,929,260 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 67,059,265 - 67,224,762 (+) NCBI UU_Cfam_GSD_1.0
Meis1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 17,354,842 - 17,491,236 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 11,079,455 - 11,217,388 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 11,079,574 - 11,216,451 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MEIS1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 75,485,022 - 75,625,040 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 75,485,024 - 75,625,855 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 79,331,016 - 79,362,238 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MEIS1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 40,473,148 - 40,613,245 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 40,471,063 - 40,611,071 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 71,303,335 - 71,444,475 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Meis1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 405 Count of miRNA genes: 229 Interacting mature miRNAs: 281 Transcripts: ENSRNOT00000006157 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582201 Sffal2 Serum free fatty acids level QTL 2 4 0.0002 blood free fatty acid amount (VT:0001553) serum free fatty acids level (CMO:0000547) 14 92553886 95876975 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 631213 Bw60 Body weight QTL60 4.51 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 79950921 95876975 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 1582250 Gluco26 Glucose level QTL 26 3.3 0.0009 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 95876975 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 4889951 Bss92 Bone structure and strength QTL 92 3.9 tibia area (VT:1000281) tibia-fibula cortical bone total cross-sectional area (CMO:0001721) 14 82057471 95876975 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006157 ⟹ ENSRNOP00000006157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 93,155,435 - 93,291,701 (-) Ensembl Rnor_6.0 Ensembl 14 103,181,281 - 103,321,270 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098187 ⟹ ENSRNOP00000083074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 93,178,917 - 93,293,720 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104415 ⟹ ENSRNOP00000089570
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 93,155,435 - 93,294,260 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107521 ⟹ ENSRNOP00000097699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 93,155,419 - 93,294,265 (-) Ensembl
RefSeq Acc Id:
NM_001134702 ⟹ NP_001128174
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,356,949 - 97,495,083 (-) NCBI mRatBN7.2 14 93,155,433 - 93,293,595 (-) NCBI Rnor_6.0 14 103,182,178 - 103,321,129 (-) NCBI Rnor_5.0 14 102,927,220 - 103,064,633 (-) NCBI RGSC_v3.4 14 99,693,567 - 99,832,273 (-) RGD Celera 14 92,182,045 - 92,319,516 (-) RGD
Sequence:
CTGGCCTTAAAGAGGATATATTAGAAGTTGAAGAAGGAAGGGAGGCAGAGAGGCCGATGGCGCAAAGGTACGACGATCTACCCCATTATGGGGGCATGGATGGAGTAGGCATCCCCTCCACGATGTAT GGGGACCCGCATGCAGCCAGGTCTATGCAGCCGGTCCACCACCTGAACCACGGGCCTCCTCTGCACTCTCATCAGTACCCGCACACAGCTCATACCAACGCCATGGCCCCCAGCATGGGCTCCTCAGT CAATGACGCTTTAAAGAGAGATAAAGATGCCATTTATGGACACCCCCTCTTCCCTCTCTTAGCACTGATTTTTGAGAAATGTGAATTAGCTACTTGTACCCCCCGCGAGCCGGGGGTGGCGGGCGGGG ACGTCTGCTCGTCAGAGTCATTCAATGAAGATATAGCGGTGTTCGCCAAACAGATTCGTGCAGAAAAACCTCTATTCTCTTCTAATCCAGAACTGGATAACTTGATGATCCAAGCCATACAAGTATTA AGGTTTCATCTGTTGGAATTAGAGAAGGTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAAATGCCTATCGATTTGGTGATAGATGATAGAGAAGGCGGATCAAA ATCAGACAGTGAAGATGTAACAAGAGCAGCAAATCTAACTGACCAGCCCTCTTGGAATAGAGACCATGATGACACGGCATCCACTCGTTCAGGAGGAACCCCGGGCCCTTCCAGCGGTGGCCACACTT CACACAGTGGGGATAACAGCAGTGAGCAAGGTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACAGGTGACGATGATGACCCTGATAAGGACAAAAAGCGTCACAAAAAGCGTGGCATCTTTCCC AAAGTAGCCACCAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACACACCCTTACCCTTCTGAAGAGCAGAAAAAGCAGTTGGCACAAGATACGGGACTCACCATCCTTCAAGTGAACAATTGGTT TATTAATGCGCGGAGAAGAATAGTGCAGCCCATGATAGATCAGTCCAACCGAGCAGTCAGCCAAGGGACACCTTATAACCCCGATGGACAGCCAATGGGAGGTTTTGTAATGGACGGTCAGCAGCACA TGGGCATCAGAGCGCCAGGACCTATGAGTGGAATGGGCATGAATATGGGCATGGAGGGGCAGTGGCACTACATGTAACGTTCATCTAGTTAACCAATCGAAAGCCAGGGGGAAGGCTGCAAAGTATGC CAGGGGAGTATGTAGCCCGGGGTGGTCCAATGGGTGTGAGTATGGGACAGCCGAGTTATACCCAAGCCCAGATGCCCCCCCATCCTGCTCAGCTGCGTCATGGGCCCCCCATGCATACGTACATTCCT GGACATCCTCACCACCCCGCAGTGATGATGCATGGAGGACAGCCCCACCCTGGAATGCCAATGTCAGCGTCAAGCCCCTCGGTTCTTAATACAGGAGACCCGACAATGAGTGGACAAGTCATGAACAT TCACGCTCAGTAGCTTAAGGGAATATGCATTGTCTGCAATGGTGACTGATCTCGAATCATGTCTTTTTCTGCAATGACTATGGAGTTCCATTCTTGACATCTACTTTGGACCAAGGAGCATCCCTAAT TCTTCATAGGGACTCTTAAAAATGCAGGAAAACCAACCGAAGTCAATTTGGGGGACATGCAAAAATAACTATATAAGACATTAAAAGAACAAAGAGTGAAATATTGTAAATGCTATTATACTGTTATC CATATTACGTTGTTTCTTATAGATTTTTTAAAAAAAATGTGAAATTTTTCCACACTATGTGTGTTGTTTCCATAGCTCTTCACTTCCTCCAGAAGCCTCCTTACATTAAAAAGCCTTACAGTCATCCT GCAAGGGACAGGAAGGTCTGATTTGCAGGATTTTTAGAGCATTAAAATAACTATCAGGCAGAAGAATCTTTCTTCTCGCCTAGGATTTCAGCCATGTGCGCGCTCTCTCTCTCTCTCCTCTCTCTCTC TTCTCCTCTCTCTCCCTCTCTCTAGCCTGGGGCTTGAATTTGCATGTCTAATTCATTTACTCACCATATTTGAATTGGCCTGAACAGATGTAAATCGGGAAGGATGGGAAAAACTGCAGTCACCCAAC AATGATTAATCAGCTGTTGCAGGCAGTGTCTTAAGGAGACTGGTAGAAGGAGCCATGGAAACCCAAAGGCCGTGTGTTTAGAAGCCTAACTGTCACGTCAAGCGTCATCGTCCCCATGCGACAACAAC CATCACCTTATACATCACTTCCTGTTTTATGCAGCTCAAAAAAACATAGACTGAAGATTTATTTTTAATATGTTGACTTTGTTTCTCAGCAAAGCATTGGTCATGTGTGTATTTTTCCATAGTCCCAC CTTGGAGCATTTATGTAGACATTGTAAATAAATTTTGTGCAAAAAGGAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006251529 ⟹ XP_006251591
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,356,949 - 97,497,391 (-) NCBI mRatBN7.2 14 93,155,426 - 93,294,373 (-) NCBI Rnor_6.0 14 103,182,178 - 103,321,809 (-) NCBI Rnor_5.0 14 102,927,220 - 103,064,633 (-) NCBI
Sequence:
GGGTTCTAGCATTCTGGTCGGAATCCACCTCTCCGCCTGTGCAACACACACTTTACACACGCACGGCGACTGCAAGCGGGCAGCATCGATCGTGGCTCCTTTAAGACAAACTCAGACAGACATTTTTT TAACCCTCCTCTCTAATCTCCCTTCAGTGCAGCAGTTGCAAAGAGGGAGAGAGAAAGAGAAAGAGAGCGAGAGAAGAGAGAAACTGATTGGGAATTAGGACTGATTCAAGGAAAGCGGGCGCTAGGGC TTTGTGCATTTGAATATTAACATTTGAGGTGTTCTGACCAGAAGAAGACAGAACGGATGATCATTCATTCACCACGTTGACAACCTCGCCTGTGATTGACAGCTGGAGTGGCAGAAAGCCATGAGATT TGGTAGTTGGTTCTGAGGGGCGCTCTTTTTTTTCTTTTTCTTTTCTTTTCTTTCTTTTTTTTTAACTGATTTTTTTGGGGGGGAAGAGAAGATCTGCTTTTTTTTCCCTCCCACTGCTGTCTTGGTGG AACCAGAGCGCTTTTATGCTCAGCGACGCGGGCGCCTTGCTTCAGGTCCGGTAGACCGAAGATCTGGGACCAGTAATTCACACTGCTGGAGACGCAAAGGGATTTTTTTGTTACTGTTGTGCTTTATT TTTTTTTCCGAGGGAGTTTGCATATTTGTTTCTTTTCACACTGGCCTTAAAGAGGATATATTAGAAGTTGAAGAAGGAAGGGAGGCAGAGAGGCCGATGGCGCAAAGGTACGACGATCTACCCCATTA TGGGGGCATGGATGGAGTAGGCATCCCCTCCACGATGTATGGGGACCCGCATGCAGCCAGGTCTATGCAGCCGGTCCACCACCTGAACCACGGGCCTCCTCTGCACTCTCATCAGTACCCGCACACAG CTCATACCAACGCCATGGCCCCCAGCATGGGCTCCTCAGTCAATGACGCTTTAAAGAGAGATAAAGATGCCATTTATGGACACCCCCTCTTCCCTCTCTTAGCACTGATTTTTGAGAAATGTGAATTA GCTACTTGTACCCCCCGCGAGCCGGGGGTGGCGGGCGGGGACGTCTGCTCGTCAGAGTCATTCAATGAAGATATAGCGGTGTTCGCCAAACAGATTCGTGCAGAAAAACCTCTATTCTCTTCTAATCC AGAACTGGATAACTTGATGATCCAAGCCATACAAGTATTAAGGTTTCATCTGTTGGAATTAGAGAAGGTACACGAATTATGTGACAATTTCTGCCACCGGTATATTAGCTGTTTGAAAGGGAAAATGC CTATCGATTTGGTGATAGATGATAGAGAAGGCGGATCAAAATCAGACAGTGAAGATGTAACAAGAGCAGCAAATCTAACTGACCAGCCCTCTTGGAATAGAGACCATGATGACACGGCATCCACTCGT TCAGGAGGAACCCCGGGCCCTTCCAGCGGTGGCCACACTTCACACAGTGGGGATAACAGCAGTGAGCAAGGTGATGGCTTGGACAACAGTGTAGCTTCCCCCAGCACAGGTGACGATGATGACCCTGA TAAGGACAAAAAGCGTCACAAAAAGCGTGGCATCTTTCCCAAAGTAGCCACCAATATCATGAGGGCGTGGCTGTTCCAGCATCTAACACACCCTTACCCTTCTGAAGAGCAGAAAAAGCAGTTGGCAC AAGATACGGGACTCACCATCCTTCAAGTGAACAATTGGTTTATTAATGCGCGGAGAAGAATAGTGCAGCCCATGATAGATCAGTCCAACCGAGCAGTCAGCCAAGGGACACCTTATAACCCCGATGGA CAGCCAATGGGAGGTTTTGTAATGGACGGTCAGCAGCACATGGGCATCAGAGCGCCAGGGCTGCAAAGTATGCCAGGGGAGTATGTAGCCCGGGGTGGTCCAATGGGTGTGAGTATGGGACAGCCGAG TTATACCCAAGCCCAGATGCCCCCCCATCCTGCTCAGCTGCGTCATGGGCCCCCCATGCATACGTACATTCCTGGACATCCTCACCACCCCGCAGTGATGATGCATGGAGGACAGCCCCACCCTGGAA TGCCAATGTCAGCGTCAAGCCCCTCGGTTCTTAATACAGGAGACCCGACAATGAGTGGACAAGTCATGAACATTCACGCTCAGTAGCTTAAGGGAATATGCATTGTCTGCAATGGTGACTGATCTCGA ATCATGTCTTTTTCTGCAATGACTATGGAGTTCCATTCTTGACATCTACTTTGGACCAAGGAGCATCCCTAATTCTTCATAGGGACTCTTAAAAATGCAGGAAAACCAACCGAAGTCAATTTGGGGGA CATGCAAAAATAACTATATAAGACATTAAAAGAACAAAGAGTGAAATATTGTAAATGCTATTATACTGTTATCCATATTACGTTGTTTCTTATAGATTTTTTAAAAAAAATGTGAAATTTTTCCACAC TATGTGTGTTGTTTCCATAGCTCTTCACTTCCTCCAGAAGCCTCCTTACATTAAAAAGCCTTACAGTCATCCTGCAAGGGACAGGAAGGTCTGATTTGCAGGATTTTTAGAGCATTAAAATAACTATC AGGCAGAAGAATCTTTCTTCTCGCCTAGGATTTCAGCCATGTGCGCGCTCTCTCTCTCTCTCCTCTCTCTCTCTTCTCCTCTCTCTCCCTCTCTCTAGCCTGGGGCTTGAATTTGCATGTCTAATTCA TTTACTCACCATATTTGAATTGGCCTGAACAGATGTAAATCGGGAAGGATGGGAAAAACTGCAGTCACCCAACAATGATTAATCAGCTGTTGCAGGCAGTGTCTTAAGGAGACTGGTAGAAGGAGCCA TGGAAACCCAAAGGCCGTGTGTTTAGAAGCCTAACTGTCACGTCAAGCGTCATCGTCCCCATGCGACAACAACCATCACCTTATACATCACTTCCTGTTTTATGCAGCTCAAAAAAACATAGACTGAA GATTTATTTTTAATATGTTGACTTTGTTTCTCAGCAAAGCATTGGTCATGTGTGTATTTTTCCATAGTCCCACCTTGGAGCATTTATGTAGACATTGTAAATAAATTTTGTGCAAAAAGGA
hide sequence
RefSeq Acc Id:
XM_039092454 ⟹ XP_038948382
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,360,334 - 97,497,391 (-) NCBI mRatBN7.2 14 93,155,426 - 93,294,373 (-) NCBI
RefSeq Acc Id:
XM_039092455 ⟹ XP_038948383
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,356,949 - 97,487,583 (-) NCBI mRatBN7.2 14 93,155,426 - 93,286,102 (-) NCBI
RefSeq Acc Id:
XM_063273628 ⟹ XP_063129698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,356,949 - 97,497,391 (-) NCBI
RefSeq Acc Id:
XM_063273629 ⟹ XP_063129699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,356,949 - 97,499,646 (-) NCBI
RefSeq Acc Id:
XM_063273630 ⟹ XP_063129700
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,360,334 - 97,497,391 (-) NCBI
RefSeq Acc Id:
XR_005493013
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 97,360,738 - 97,497,391 (-) NCBI mRatBN7.2 14 93,159,227 - 93,294,373 (-) NCBI
RefSeq Acc Id:
NP_001128174 ⟸ NM_001134702
- UniProtKB:
B1WC31 (UniProtKB/TrEMBL), F7EL40 (UniProtKB/TrEMBL)
- Sequence:
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQI RAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDVTRAANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVA SPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGME GQWHYM
hide sequence
RefSeq Acc Id:
XP_006251591 ⟸ XM_006251529
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GMM6 (UniProtKB/TrEMBL), A6JQ06 (UniProtKB/TrEMBL)
- Sequence:
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMG SSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREG GSKSDSEDVTRAANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVN NWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGLQSMPGEYVARGGPMGVSMGQPSYTQAQMPPHPAQLRHGPPMHTYIPGHPHHPAVMMHGGQPHPGMPMSASSPSVL NTGDPTMSGQVMNIHAQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000006157 ⟸ ENSRNOT00000006157
RefSeq Acc Id:
XP_038948382 ⟸ XM_039092454
- Peptide Label:
isoform X4
- UniProtKB:
B1WC31 (UniProtKB/TrEMBL), F7EL40 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948383 ⟸ XM_039092455
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000097699 ⟸ ENSRNOT00000107521
Ensembl Acc Id:
ENSRNOP00000089570 ⟸ ENSRNOT00000104415
Ensembl Acc Id:
ENSRNOP00000083074 ⟸ ENSRNOT00000098187
RefSeq Acc Id:
XP_063129699 ⟸ XM_063273629
- Peptide Label:
isoform X3
- UniProtKB:
A6JQ06 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129698 ⟸ XM_063273628
- Peptide Label:
isoform X2
- UniProtKB:
A6JQ06 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129700 ⟸ XM_063273630
- Peptide Label:
isoform X5
- UniProtKB:
F7EL40 (UniProtKB/TrEMBL)
RGD ID: 13699506
Promoter ID: EPDNEW_R10030
Type: initiation region
Name: Meis1_1
Description: Meis homeobox 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 103,321,293 - 103,321,353 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Meis1
Meis homeobox 1
LOC108352805
uncharacterized LOC108352805
Data merged from RGD:11361306
737654
PROVISIONAL
2016-08-02
LOC108352805
uncharacterized LOC108352805
Symbol and Name status set to provisional
70820
PROVISIONAL
2008-09-18
Meis1
Meis homeobox 1
LOC686117
similar to myeloid ecotropic viral integration site 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-01-09
LOC686117
similar to myeloid ecotropic viral integration site 1
LOC679409
similar to Homeobox protein Meis1 (Myeloid ecotropic viral integration site 1)
Data merged from RGD:1588354
1643240
APPROVED
2006-11-19
LOC686117
similar to myeloid ecotropic viral integration site 1
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-11-19
LOC679409
similar to Homeobox protein Meis1 (Myeloid ecotropic viral integration site 1)
Symbol and Name status set to provisional
70820
PROVISIONAL