Symbol:
Sox2
Name:
SRY-box transcription factor 2
RGD ID:
1565646
Description:
Enables DNA-binding transcription activator activity, RNA polymerase II-specific; nitric-oxide synthase binding activity; and transcription cis-regulatory region binding activity. Involved in several processes, including cellular response to hypoxia; regulation of myofibroblast cell apoptotic process; and response to oxygen-glucose deprivation. Located in nucleus. Used to study congestive heart failure. Biomarker of alcohol use disorder; lesion of sciatic nerve; retinal degeneration; transient cerebral ischemia; and traumatic brain injury. Human ortholog(s) of this gene implicated in breast cancer; nasal cavity cancer; oral cavity cancer; and syndromic microphthalmia 3. Orthologous to human SOX2 (SRY-box transcription factor 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100912162; LOC499593; RGD1565646; similar to SOX2 protein; SRY (sex determining region Y)-box 2; SRY box 2; SRY-box containing gene 2; transcription factor SOX-2; uncharacterized LOC100912162
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 119,465,131 - 119,467,542 (+) NCBI GRCr8 mRatBN7.2 2 117,536,929 - 117,539,340 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 117,536,929 - 117,539,338 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 124,123,587 - 124,125,999 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 122,236,249 - 122,238,661 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 116,863,148 - 116,865,560 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 121,165,137 - 121,167,545 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 121,165,137 - 121,167,545 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 140,810,593 - 140,813,001 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 120,969,021 - 120,971,430 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 112,569,723 - 112,572,132 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sox2 Rat (20S)-ginsenoside Rg3 decreases expression ISO SOX2 (Homo sapiens) 6480464 ginsenoside Rg3 results in decreased expression of SOX2 mRNA CTD PMID:31916386 Sox2 Rat (R)-pantothenic acid decreases expression ISO SOX2 (Homo sapiens) 6480464 Pantothenic Acid results in decreased expression of SOX2 mRNA CTD PMID:19397697 Sox2 Rat (S)-naringenin decreases expression ISO SOX2 (Homo sapiens) 6480464 naringenin results in decreased expression of SOX2 protein CTD PMID:27468969 Sox2 Rat 1,2-dichloroethane decreases expression ISO Sox2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SOX2 mRNA CTD PMID:28960355 Sox2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SOX2 mRNA CTD PMID:30387366 Sox2 Rat 17beta-estradiol decreases expression ISO SOX2 (Homo sapiens) 6480464 Estradiol results in decreased expression of SOX2 mRNA CTD PMID:16474171 more ... Sox2 Rat 17beta-estradiol increases activity ISO SOX2 (Homo sapiens) 6480464 Estradiol results in increased activity of SOX2 protein CTD PMID:27592001 Sox2 Rat 17beta-estradiol increases expression ISO SOX2 (Homo sapiens) 6480464 Estradiol results in increased expression of SOX2 mRNA CTD PMID:24424067 Sox2 Rat 17beta-estradiol multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Arsenic co-treated with Estradiol] results in decreased expression of SOX2 mRNA and [Estradiol binds to ESR2 protein] which results in increased expression of SOX2 mRNA CTD PMID:20404318 and PMID:33047385 Sox2 Rat 17beta-estradiol 3-benzoate decreases methylation EXP 6480464 estradiol 3-benzoate results in decreased methylation of SOX2 promoter CTD PMID:27415467 Sox2 Rat 17beta-estradiol 3-benzoate increases expression EXP 6480464 estradiol 3-benzoate results in increased expression of SOX2 mRNA CTD PMID:27415467 Sox2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Sox2 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Sox2 (Mus musculus) 6480464 2 more ... CTD PMID:34547414 Sox2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO SOX2 (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Sox2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sox2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SOX2 mRNA and Tetrachlorodibenzodioxin affects the expression of SOX2 protein CTD PMID:21570461 more ... Sox2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO SOX2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of SOX2 mRNA CTD PMID:30203000 Sox2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO SOX2 (Homo sapiens) 6480464 N-(2-(3H-indol-3-yl)ethyl)-9-isopropyl-2-(5-methyl-3-pyridyl)purin-6-amine inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of SOX2 mRNA] CTD PMID:30203000 Sox2 Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Verapamil co-treated with kaempferol] results in decreased expression of SOX2 mRNA CTD PMID:35063459 Sox2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone] results in decreased expression of SOX2 mRNA CTD PMID:21350315 Sox2 Rat 3-methyladenine increases expression ISO Sox2 (Mus musculus) 6480464 3-methyladenine results in increased expression of SOX2 mRNA CTD PMID:21681844 Sox2 Rat 4,4'-sulfonyldiphenol increases expression ISO SOX2 (Homo sapiens) 6480464 bisphenol S results in increased expression of SOX2 mRNA CTD PMID:36565802 Sox2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SOX2 (Homo sapiens) 6480464 [bisphenol S co-treated with perfluorooctane sulfonic acid] results in decreased expression of SOX2 mRNA CTD PMID:37834465 Sox2 Rat 5-aza-2'-deoxycytidine decreases expression ISO Sox2 (Mus musculus) 6480464 Decitabine results in decreased expression of SOX2 mRNA CTD PMID:27915011 Sox2 Rat 5-azacytidine increases expression EXP 6480464 Azacitidine results in increased expression of SOX2 mRNA CTD PMID:27415467 Sox2 Rat 5-fluorouracil decreases expression ISO Sox2 (Mus musculus) 6480464 Fluorouracil results in decreased expression of SOX2 protein CTD PMID:21296659 Sox2 Rat 6-bromoindirubin-3'-oxime multiple interactions ISO SOX2 (Homo sapiens) 6480464 [trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of SOX2 protein and XAV939 inhibits the reaction [[trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of SOX2 protein] CTD PMID:37116855 Sox2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SOX2 mRNA CTD PMID:30047161 Sox2 Rat 9-cis-retinoic acid decreases expression ISO SOX2 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of SOX2 mRNA CTD PMID:36805303 Sox2 Rat acrylamide decreases expression ISO SOX2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SOX2 mRNA and Acrylamide results in decreased expression of SOX2 protein CTD PMID:32763439 Sox2 Rat aflatoxin B1 decreases methylation ISO SOX2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SOX2 gene CTD PMID:27153756 Sox2 Rat aflatoxin M1 decreases expression ISO SOX2 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of SOX2 mRNA CTD PMID:30928695 Sox2 Rat aldehydo-D-glucose decreases expression ISO SOX2 (Homo sapiens) 6480464 Glucose results in decreased expression of SOX2 protein CTD PMID:33992720 Sox2 Rat all-trans-retinoic acid multiple interactions ISO Sox2 (Mus musculus) 6480464 NR6A1 protein affects the reaction [Tretinoin results in decreased expression of SOX2 mRNA] and Tretinoin results in decreased expression of and results in increased degradation of SOX2 protein CTD PMID:16166633 and PMID:30442713 Sox2 Rat all-trans-retinoic acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:30093655 more ... Sox2 Rat all-trans-retinoic acid affects expression ISO SOX2 (Homo sapiens) 6480464 Tretinoin affects the expression of SOX2 mRNA CTD PMID:31600526 Sox2 Rat all-trans-retinoic acid increases degradation ISO Sox2 (Mus musculus) 6480464 Tretinoin results in increased degradation of SOX2 protein modified form CTD PMID:30442713 Sox2 Rat all-trans-retinoic acid decreases expression ISO SOX2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SOX2 mRNA CTD PMID:21934132 more ... Sox2 Rat Anatoxin a multiple interactions ISO SOX2 (Homo sapiens) 6480464 anatoxin a promotes the reaction [Tretinoin results in decreased expression of SOX2 mRNA] CTD PMID:38070836 Sox2 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO SOX2 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [sodium arsenite results in increased expression of SOX2 protein] CTD PMID:23219847 Sox2 Rat antirheumatic drug increases expression ISO SOX2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SOX2 mRNA CTD PMID:24449571 Sox2 Rat Antrocin decreases expression ISO SOX2 (Homo sapiens) 6480464 antrocin analog results in decreased expression of SOX2 protein CTD PMID:36565974 Sox2 Rat apigenin decreases expression ISO SOX2 (Homo sapiens) 6480464 Apigenin results in decreased expression of SOX2 protein CTD PMID:27468969 Sox2 Rat Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SOX2 mRNA CTD PMID:34858468 Sox2 Rat arotinoid acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Sox2 Rat arsane increases expression ISO Sox2 (Mus musculus) 6480464 Arsenic results in increased expression of SOX2 mRNA and Arsenic results in increased expression of SOX2 protein CTD PMID:23221970 and PMID:33124703 Sox2 Rat arsane multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Arsenic co-treated with Estradiol] results in decreased expression of SOX2 mRNA and [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of SOX2 mRNA CTD PMID:32525701 and PMID:33047385 Sox2 Rat arsane increases expression ISO SOX2 (Homo sapiens) 6480464 Arsenic results in increased expression of SOX2 mRNA CTD PMID:29396848 Sox2 Rat arsenic atom increases expression ISO Sox2 (Mus musculus) 6480464 Arsenic results in increased expression of SOX2 mRNA and Arsenic results in increased expression of SOX2 protein CTD PMID:23221970 and PMID:33124703 Sox2 Rat arsenic atom multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Arsenic co-treated with Estradiol] results in decreased expression of SOX2 mRNA and [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of SOX2 mRNA CTD PMID:32525701 and PMID:33047385 Sox2 Rat arsenic atom increases expression ISO SOX2 (Homo sapiens) 6480464 Arsenic results in increased expression of SOX2 mRNA CTD PMID:29396848 Sox2 Rat arsenite(3-) decreases expression ISO SOX2 (Homo sapiens) 6480464 arsenite results in decreased expression of SOX2 mRNA CTD PMID:23974009 Sox2 Rat arsenous acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 4-(4-cyano-2-(2-(4-fluoronaphthalen-1-yl)propionylamino)phenyl)butyric acid inhibits the reaction [Arsenic Trioxide results in increased expression of SOX2 protein] more ... CTD PMID:29396848 more ... Sox2 Rat arsenous acid decreases expression ISO SOX2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SOX2 mRNA CTD PMID:24685274 and PMID:33634982 Sox2 Rat arsenous acid decreases response to substance ISO SOX2 (Homo sapiens) 6480464 SOX2 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:21703238 Sox2 Rat arsenous acid increases expression ISO SOX2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SOX2 mRNA and Arsenic Trioxide results in increased expression of SOX2 protein CTD PMID:29396848 and PMID:29486283 Sox2 Rat aspartame affects localization ISO SOX2 (Homo sapiens) 6480464 Aspartame affects the localization of SOX2 protein CTD PMID:33992720 Sox2 Rat azithromycin decreases expression ISO Sox2 (Mus musculus) 6480464 Azithromycin results in decreased expression of SOX2 mRNA and Azithromycin results in decreased expression of SOX2 protein CTD PMID:37995777 Sox2 Rat benzo[a]pyrene decreases expression ISO Sox2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SOX2 mRNA CTD PMID:22228805 and PMID:27195522 Sox2 Rat benzo[a]pyrene decreases expression ISO SOX2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SOX2 mRNA and Benzo(a)pyrene results in decreased expression of SOX2 protein CTD PMID:30659931 Sox2 Rat beta-lapachone decreases expression ISO SOX2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SOX2 mRNA CTD PMID:38218311 Sox2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO SOX2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of SOX2 mRNA CTD PMID:31163220 Sox2 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SOX2 protein CTD PMID:35841924 Sox2 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of SOX2 protein] CTD PMID:35841924 Sox2 Rat bisphenol A decreases expression ISO SOX2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SOX2 mRNA CTD PMID:16474171 and PMID:25051057 Sox2 Rat bisphenol A decreases expression ISO Sox2 (Mus musculus) 6480464 bisphenol A results in decreased expression of SOX2 mRNA CTD PMID:35219798 Sox2 Rat bisphenol A multiple interactions ISO SOX2 (Homo sapiens) 6480464 bisphenol A promotes the reaction [CREB1 protein modified form binds to SOX2 enhancer] CTD PMID:28244015 Sox2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SOX2 mRNA CTD PMID:27415467 and PMID:30387366 Sox2 Rat bisphenol A affects methylation ISO Sox2 (Mus musculus) 6480464 bisphenol A affects the methylation of SOX2 promoter CTD PMID:27334623 Sox2 Rat bisphenol A increases expression ISO SOX2 (Homo sapiens) 6480464 bisphenol A results in increased expression of SOX2 mRNA and bisphenol A results in increased expression of SOX2 protein CTD PMID:28244015 more ... Sox2 Rat bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of SOX2 promoter CTD PMID:27415467 Sox2 Rat bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of SOX2 promoter CTD PMID:28728135 Sox2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SOX2 mRNA CTD PMID:25181051 and PMID:29097150 Sox2 Rat bisphenol A increases expression ISO Sox2 (Mus musculus) 6480464 bisphenol A results in increased expression of SOX2 mRNA and bisphenol A results in increased expression of SOX2 protein CTD PMID:23719110 more ... Sox2 Rat Bisphenol A diglycidyl ether affects expression ISO Sox2 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the expression of SOX2 mRNA CTD PMID:36464114 Sox2 Rat bisphenol AF affects expression ISO Sox2 (Mus musculus) 6480464 bisphenol AF affects the expression of SOX2 mRNA CTD PMID:36464114 Sox2 Rat bromochloroacetic acid affects expression ISO Sox2 (Mus musculus) 6480464 bromochloroacetic acid affects the expression of SOX2 protein CTD PMID:21296659 Sox2 Rat buta-1,3-diene decreases expression ISO Sox2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of SOX2 mRNA CTD PMID:29038090 Sox2 Rat butanal decreases expression ISO SOX2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of SOX2 mRNA CTD PMID:26079696 Sox2 Rat cadmium dichloride affects expression ISO Sox2 (Mus musculus) 6480464 Cadmium Chloride affects the expression of SOX2 mRNA CTD PMID:18974090 Sox2 Rat cadmium sulfate increases expression ISO Sox2 (Mus musculus) 6480464 cadmium sulfate results in increased expression of SOX2 mRNA CTD PMID:19274763 Sox2 Rat carbofuran decreases expression EXP 6480464 Carbofuran results in decreased expression of SOX2 protein CTD PMID:22240977 Sox2 Rat carbon atom multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Carbon] which results in decreased expression of SOX2 mRNA CTD PMID:31791492 Sox2 Rat carbon nanotube decreases expression ISO Sox2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of SOX2 mRNA CTD PMID:25554681 Sox2 Rat carboplatin increases expression ISO SOX2 (Homo sapiens) 6480464 Carboplatin results in increased expression of SOX2 mRNA CTD PMID:25605917 Sox2 Rat carvedilol increases expression EXP 6480464 carvedilol results in increased expression of SOX2 mRNA CTD PMID:27288437 Sox2 Rat carvedilol increases expression ISO Sox2 (Mus musculus) 6480464 carvedilol results in increased expression of SOX2 mRNA CTD PMID:27288437 Sox2 Rat celecoxib multiple interactions ISO SOX2 (Homo sapiens) 6480464 Celecoxib inhibits the reaction [Arsenic Trioxide results in increased expression of SOX2 protein] and Dinoprostone inhibits the reaction [Celecoxib inhibits the reaction [Arsenic Trioxide results in increased expression of SOX2 protein]] CTD PMID:29396848 Sox2 Rat CGP 52608 multiple interactions ISO SOX2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SOX2 gene] CTD PMID:28238834 Sox2 Rat CHIR 99021 decreases expression ISO SOX2 (Homo sapiens) 6480464 Chir 99021 results in decreased expression of SOX2 mRNA CTD PMID:31711903 Sox2 Rat CHIR 99021 multiple interactions ISO SOX2 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:31711903 and PMID:34480604 Sox2 Rat chlordecone increases expression ISO Sox2 (Mus musculus) 6480464 Chlordecone results in increased expression of SOX2 mRNA CTD PMID:33711761 Sox2 Rat chloroprene increases expression ISO Sox2 (Mus musculus) 6480464 Chloroprene results in increased expression of SOX2 mRNA CTD PMID:23125180 Sox2 Rat chlorpromazine decreases expression ISO SOX2 (Homo sapiens) 6480464 Chlorpromazine results in decreased expression of SOX2 mRNA CTD PMID:30703373 Sox2 Rat chromium(6+) multiple interactions ISO Sox2 (Mus musculus) 6480464 MAP2K7 protein promotes the reaction [chromium hexavalent ion results in increased expression of SOX2 mRNA] CTD PMID:19654923 Sox2 Rat chromium(6+) increases expression ISO Sox2 (Mus musculus) 6480464 chromium hexavalent ion results in increased expression of SOX2 mRNA CTD PMID:19654923 Sox2 Rat chrysene increases expression ISO Sox2 (Mus musculus) 6480464 chrysene results in increased expression of SOX2 mRNA CTD PMID:26377693 Sox2 Rat ciprofloxacin decreases expression ISO SOX2 (Homo sapiens) 6480464 Ciprofloxacin results in decreased expression of SOX2 protein CTD PMID:26947806 Sox2 Rat cisplatin multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of SOX2 mRNA more ... CTD PMID:20705681 more ... Sox2 Rat Citreoviridin increases expression ISO Sox2 (Mus musculus) 6480464 citreoviridin results in increased expression of SOX2 mRNA CTD PMID:30071239 Sox2 Rat cobalt atom multiple interactions ISO SOX2 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in decreased expression of SOX2 mRNA CTD PMID:20105288 Sox2 Rat cobalt dichloride multiple interactions ISO SOX2 (Homo sapiens) 6480464 [EPAS1 protein results in increased susceptibility to cobaltous chloride] which results in increased expression of SOX2 mRNA more ... CTD PMID:24842335 and PMID:25805230 Sox2 Rat cobalt dichloride decreases expression ISO SOX2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SOX2 mRNA CTD PMID:20105288 Sox2 Rat cobalt dichloride increases expression ISO SOX2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SOX2 protein CTD PMID:24842335 Sox2 Rat colforsin daropate hydrochloride decreases expression ISO SOX2 (Homo sapiens) 6480464 Colforsin results in decreased expression of SOX2 protein CTD PMID:34897981 Sox2 Rat cordycepin multiple interactions ISO SOX2 (Homo sapiens) 6480464 sirtinol inhibits the reaction [cordycepin results in increased expression of SOX2 mRNA] CTD PMID:36881089 Sox2 Rat cordycepin affects expression ISO Sox2 (Mus musculus) 6480464 cordycepin affects the expression of SOX2 protein CTD PMID:32042022 Sox2 Rat cordycepin affects expression ISO SOX2 (Homo sapiens) 6480464 cordycepin affects the expression of SOX2 mRNA CTD PMID:36881089 Sox2 Rat cortisol multiple interactions ISO SOX2 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Sox2 Rat crystal violet multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Gentian Violet results in decreased phosphorylation of and affects the localization of STAT3 protein] inhibits the reaction [STAT3 protein binds to SOX2 promoter] CTD PMID:27373978 Sox2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of SOX2 mRNA CTD PMID:27523638 Sox2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SOX2 mRNA CTD PMID:26577399 Sox2 Rat curcumin increases expression ISO Sox2 (Mus musculus) 6480464 Curcumin results in increased expression of SOX2 mRNA and Curcumin results in increased expression of SOX2 protein CTD PMID:25822711 Sox2 Rat D-glucose decreases expression ISO SOX2 (Homo sapiens) 6480464 Glucose results in decreased expression of SOX2 protein CTD PMID:33992720 Sox2 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of SOX2 mRNA CTD PMID:23640034 Sox2 Rat decabromodiphenyl ether decreases expression ISO SOX2 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of SOX2 mRNA CTD PMID:26206603 Sox2 Rat decabromodiphenyl ether increases expression ISO SOX2 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of SOX2 mRNA CTD PMID:31326446 Sox2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of SOX2 mRNA CTD PMID:23640034 Sox2 Rat dehydroepiandrosterone decreases expression ISO SOX2 (Homo sapiens) 6480464 Dehydroepiandrosterone results in decreased expression of SOX2 mRNA and Dehydroepiandrosterone results in decreased expression of SOX2 protein CTD PMID:39285669 Sox2 Rat dehydroepiandrosterone multiple interactions ISO SOX2 (Homo sapiens) 6480464 nuciferine inhibits the reaction [Dehydroepiandrosterone results in decreased expression of SOX2 mRNA] more ... CTD PMID:39285669 Sox2 Rat deoxycholic acid increases expression ISO Sox2 (Mus musculus) 6480464 Deoxycholic Acid results in increased expression of SOX2 mRNA CTD PMID:27151938 Sox2 Rat dexamethasone multiple interactions EXP 6480464 [INS co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone] results in decreased expression of SOX2 mRNA and MIR134 mRNA affects the reaction [Dexamethasone results in decreased expression of SOX2 mRNA] CTD PMID:21350315 and PMID:33619658 Sox2 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of SOX2 mRNA and Dexamethasone results in decreased expression of SOX2 protein CTD PMID:33619658 Sox2 Rat dexamethasone multiple interactions ISO Sox2 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of SOX2 mRNA CTD PMID:28189605 Sox2 Rat diallyl trisulfide decreases expression ISO SOX2 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of SOX2 mRNA and diallyl trisulfide results in decreased expression of SOX2 protein CTD PMID:33751676 and PMID:38821455 Sox2 Rat diallyl trisulfide multiple interactions ISO SOX2 (Homo sapiens) 6480464 Iodoacetamide inhibits the reaction [diallyl trisulfide results in decreased expression of SOX2 protein] CTD PMID:33751676 Sox2 Rat diarsenic trioxide increases expression ISO SOX2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of SOX2 mRNA and Arsenic Trioxide results in increased expression of SOX2 protein CTD PMID:29396848 and PMID:29486283 Sox2 Rat diarsenic trioxide multiple interactions ISO SOX2 (Homo sapiens) 6480464 4-(4-cyano-2-(2-(4-fluoronaphthalen-1-yl)propionylamino)phenyl)butyric acid inhibits the reaction [Arsenic Trioxide results in increased expression of SOX2 protein] more ... CTD PMID:29396848 more ... Sox2 Rat diarsenic trioxide decreases expression ISO SOX2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SOX2 mRNA CTD PMID:24685274 and PMID:33634982 Sox2 Rat diarsenic trioxide decreases response to substance ISO SOX2 (Homo sapiens) 6480464 SOX2 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:21703238 Sox2 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of SOX2 mRNA CTD PMID:17005392 Sox2 Rat dioxygen increases expression ISO SOX2 (Homo sapiens) 6480464 [Oxygen deficiency results in increased expression of CA9 mRNA] which results in increased expression of SOX2 mRNA CTD PMID:26305601 Sox2 Rat dioxygen decreases expression ISO SOX2 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of SOX2 protein CTD PMID:38909692 Sox2 Rat dorsomorphin multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sox2 Rat eckol decreases expression ISO SOX2 (Homo sapiens) 6480464 eckol results in decreased expression of SOX2 protein CTD PMID:21514314 Sox2 Rat elemental carbon multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Carbon] which results in decreased expression of SOX2 mRNA CTD PMID:31791492 Sox2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of SOX2 mRNA and Ethanol results in increased expression of SOX2 protein CTD PMID:29769550 Sox2 Rat etodolac multiple interactions ISO SOX2 (Homo sapiens) 6480464 Etodolac inhibits the reaction [Arsenic Trioxide results in increased expression of SOX2 protein] CTD PMID:29396848 Sox2 Rat etoposide multiple interactions ISO SOX2 (Homo sapiens) 6480464 FTL protein affects the reaction [Etoposide results in increased expression of SOX2 protein] CTD PMID:33969609 Sox2 Rat fluoxetine affects expression ISO Sox2 (Mus musculus) 6480464 Fluoxetine affects the expression of SOX2 mRNA CTD PMID:29893963 Sox2 Rat flurbiprofen increases expression ISO Sox2 (Mus musculus) 6480464 Flurbiprofen results in increased expression of SOX2 mRNA CTD PMID:16949054 Sox2 Rat folic acid decreases expression ISO Sox2 (Mus musculus) 6480464 Folic Acid results in decreased expression of SOX2 mRNA CTD PMID:25629700 Sox2 Rat fonofos increases methylation ISO SOX2 (Homo sapiens) 6480464 Fonofos results in increased methylation of SOX2 promoter CTD PMID:22847954 Sox2 Rat formaldehyde decreases expression ISO SOX2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SOX2 mRNA CTD PMID:20655997 Sox2 Rat gemcitabine increases expression ISO SOX2 (Homo sapiens) 6480464 Gemcitabine results in increased expression of SOX2 mRNA CTD PMID:25605917 Sox2 Rat genistein decreases expression ISO SOX2 (Homo sapiens) 6480464 Genistein results in decreased expression of SOX2 mRNA CTD PMID:16474171 Sox2 Rat glucose decreases expression ISO SOX2 (Homo sapiens) 6480464 Glucose results in decreased expression of SOX2 protein CTD PMID:33992720 Sox2 Rat glycerol 2-phosphate multiple interactions ISO Sox2 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of SOX2 mRNA CTD PMID:28189605 Sox2 Rat GS-441524 increases expression ISO Sox2 (Mus musculus) 6480464 GS-441524 results in increased expression of SOX2 mRNA CTD PMID:35605700 Sox2 Rat hexachlorophene decreases expression ISO Sox2 (Mus musculus) 6480464 Hexachlorophene results in decreased expression of SOX2 mRNA and Hexachlorophene results in decreased expression of SOX2 protein CTD PMID:25943520 Sox2 Rat hydroquinone decreases expression ISO SOX2 (Homo sapiens) 6480464 hydroquinone results in decreased expression of SOX2 mRNA CTD PMID:31256213 Sox2 Rat Indeno[1,2,3-cd]pyrene increases expression ISO SOX2 (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:35687267 Sox2 Rat isoorientin decreases expression ISO SOX2 (Homo sapiens) 6480464 homoorientin results in decreased expression of SOX2 protein CTD PMID:34019859 Sox2 Rat ivermectin decreases expression ISO SOX2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SOX2 mRNA and Ivermectin results in decreased expression of SOX2 protein CTD PMID:29257278 Sox2 Rat kaempferol decreases expression ISO SOX2 (Homo sapiens) 6480464 kaempferol results in decreased expression of SOX2 mRNA CTD PMID:35063459 Sox2 Rat kaempferol multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Verapamil co-treated with kaempferol] results in decreased expression of SOX2 mRNA CTD PMID:35063459 Sox2 Rat L-ascorbic acid increases expression ISO SOX2 (Homo sapiens) 6480464 Ascorbic Acid results in increased expression of SOX2 mRNA CTD PMID:21166886 Sox2 Rat L-ascorbic acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of SOX2 mRNA CTD PMID:34480604 Sox2 Rat L-ascorbic acid multiple interactions ISO Sox2 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of SOX2 mRNA CTD PMID:28189605 Sox2 Rat L-ascorbic acid 2-phosphate multiple interactions ISO SOX2 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of SOX2 mRNA CTD PMID:34480604 Sox2 Rat lapatinib multiple interactions ISO SOX2 (Homo sapiens) 6480464 [lapatinib results in decreased susceptibility to lapatinib] which results in increased expression of SOX2 protein CTD PMID:26643609 Sox2 Rat lead diacetate increases expression ISO Sox2 (Mus musculus) 6480464 lead acetate results in increased expression of SOX2 mRNA CTD PMID:31715224 Sox2 Rat lupeol decreases expression ISO Sox2 (Mus musculus) 6480464 lupeol results in decreased expression of SOX2 protein CTD PMID:20979057 Sox2 Rat LY294002 multiple interactions ISO Sox2 (Mus musculus) 6480464 [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with sodium arsenite] results in decreased expression of SOX2 protein CTD PMID:23143138 Sox2 Rat LY294002 decreases expression ISO Sox2 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased expression of SOX2 protein CTD PMID:23143138 Sox2 Rat mercury dibromide decreases expression ISO SOX2 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of SOX2 mRNA CTD PMID:26272509 Sox2 Rat mercury dibromide multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SOX2 mRNA CTD PMID:30047161 Sox2 Rat methylmercury chloride decreases expression ISO SOX2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SOX2 mRNA CTD PMID:28001369 Sox2 Rat methylmercury chloride increases expression ISO SOX2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SOX2 mRNA and methylmercuric chloride results in increased expression of SOX2 protein CTD PMID:34328791 Sox2 Rat methylparaben increases expression ISO SOX2 (Homo sapiens) 6480464 methylparaben results in increased expression of SOX2 mRNA CTD PMID:27581495 Sox2 Rat miconazole increases expression ISO Sox2 (Mus musculus) 6480464 Miconazole results in increased expression of SOX2 mRNA CTD PMID:27462272 Sox2 Rat naphthalene increases expression ISO Sox2 (Mus musculus) 6480464 naphthalene results in increased expression of SOX2 protein CTD PMID:16239640 Sox2 Rat nickel dichloride increases expression ISO SOX2 (Homo sapiens) 6480464 nickel chloride results in increased expression of SOX2 protein CTD PMID:26962057 Sox2 Rat Nonylphenol increases expression ISO Sox2 (Mus musculus) 6480464 nonylphenol results in increased expression of SOX2 mRNA CTD PMID:31288075 Sox2 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of SOX2 protein CTD PMID:39111523 Sox2 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of SOX2 mRNA CTD PMID:21703336 Sox2 Rat ochratoxin A multiple interactions EXP 6480464 SHH protein modified form inhibits the reaction [ochratoxin A results in decreased expression of SOX2 mRNA] CTD PMID:21703336 Sox2 Rat ozone multiple interactions ISO Sox2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of SOX2 mRNA CTD PMID:34911549 Sox2 Rat p-chloromercuribenzoic acid decreases expression ISO SOX2 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of SOX2 mRNA CTD PMID:26272509 Sox2 Rat p-chloromercuribenzoic acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat paclitaxel multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of SOX2 mRNA CTD PMID:20705681 Sox2 Rat panobinostat multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat panobinostat decreases expression ISO SOX2 (Homo sapiens) 6480464 panobinostat results in decreased expression of SOX2 mRNA CTD PMID:26272509 Sox2 Rat paracetamol increases expression ISO SOX2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SOX2 mRNA CTD PMID:26690555 Sox2 Rat paraquat decreases expression ISO Sox2 (Mus musculus) 6480464 Paraquat results in decreased expression of SOX2 mRNA CTD PMID:21463325 Sox2 Rat parathion increases methylation ISO SOX2 (Homo sapiens) 6480464 Parathion results in increased methylation of SOX2 promoter CTD PMID:22847954 Sox2 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Sox2 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of SOX2 mRNA and perfluorooctane sulfonic acid results in decreased expression of SOX2 protein CTD PMID:24098361 Sox2 Rat perfluorooctane-1-sulfonic acid decreases expression ISO SOX2 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of SOX2 mRNA CTD PMID:37834465 Sox2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 [bisphenol S co-treated with perfluorooctane sulfonic acid] results in decreased expression of SOX2 mRNA CTD PMID:37834465 Sox2 Rat perfluorooctane-1-sulfonic acid increases expression ISO Sox2 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of SOX2 mRNA and perfluorooctane sulfonic acid results in increased expression of SOX2 protein CTD PMID:25510869 Sox2 Rat phenylephrine multiple interactions EXP 6480464 Phenylephrine inhibits the reaction [Iodine-131 inhibits the reaction [PAFAH1B1 protein binds to SOX2 protein]] CTD PMID:32278511 Sox2 Rat phenylmercury acetate decreases expression ISO SOX2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SOX2 mRNA CTD PMID:26272509 Sox2 Rat phenylmercury acetate multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat poly(I:C) increases expression ISO SOX2 (Homo sapiens) 6480464 Poly I-C results in increased expression of SOX2 protein CTD PMID:29486283 Sox2 Rat poly(I:C) multiple interactions ISO SOX2 (Homo sapiens) 6480464 Poly I-C promotes the reaction [MSI1 protein results in increased expression of SOX2 protein] CTD PMID:29486283 Sox2 Rat PRIM-O-GLUCOSYLCIMIFUGIN increases expression EXP 6480464 prim-O-glucosylcimifugin results in increased expression of SOX2 mRNA CTD PMID:37872152 Sox2 Rat prostaglandin E2 multiple interactions ISO SOX2 (Homo sapiens) 6480464 Dinoprostone inhibits the reaction [Celecoxib inhibits the reaction [Arsenic Trioxide results in increased expression of SOX2 protein]] CTD PMID:29396848 Sox2 Rat quercetin decreases expression ISO SOX2 (Homo sapiens) 6480464 Quercetin results in decreased expression of SOX2 protein CTD PMID:27468969 Sox2 Rat remdesivir decreases expression ISO Sox2 (Mus musculus) 6480464 remdesivir results in decreased expression of SOX2 mRNA CTD PMID:35605700 Sox2 Rat resveratrol decreases expression ISO SOX2 (Homo sapiens) 6480464 resveratrol results in decreased expression of SOX2 mRNA and resveratrol results in decreased expression of SOX2 protein CTD PMID:21304978 and PMID:23651583 Sox2 Rat S-nitrosoglutathione decreases expression ISO SOX2 (Homo sapiens) 6480464 S-Nitrosoglutathione results in decreased expression of SOX2 mRNA CTD PMID:38825487 Sox2 Rat SB 431542 multiple interactions ISO SOX2 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:27188386 more ... Sox2 Rat serpentine asbestos affects methylation ISO SOX2 (Homo sapiens) 6480464 Asbestos and Serpentine affects the methylation of SOX2 exon CTD PMID:29523930 Sox2 Rat silicon dioxide decreases expression ISO SOX2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SOX2 mRNA and Silicon Dioxide results in decreased expression of SOX2 protein CTD PMID:25895662 and PMID:35288261 Sox2 Rat silicon dioxide multiple interactions ISO SOX2 (Homo sapiens) 6480464 BMI1 protein inhibits the reaction [Silicon Dioxide results in decreased expression of SOX2 protein] CTD PMID:35288261 Sox2 Rat silver atom decreases expression ISO SOX2 (Homo sapiens) 6480464 Silver results in decreased expression of SOX2 mRNA CTD PMID:26551752 Sox2 Rat silver atom decreases expression ISO Sox2 (Mus musculus) 6480464 Silver results in decreased expression of SOX2 mRNA CTD PMID:27131904 Sox2 Rat silver(0) decreases expression ISO SOX2 (Homo sapiens) 6480464 Silver results in decreased expression of SOX2 mRNA CTD PMID:26551752 Sox2 Rat silver(0) decreases expression ISO Sox2 (Mus musculus) 6480464 Silver results in decreased expression of SOX2 mRNA CTD PMID:27131904 Sox2 Rat sirolimus increases expression ISO Sox2 (Mus musculus) 6480464 Sirolimus results in increased expression of SOX2 mRNA CTD PMID:21681844 Sox2 Rat sirtinol multiple interactions ISO SOX2 (Homo sapiens) 6480464 sirtinol inhibits the reaction [cordycepin results in increased expression of SOX2 mRNA] CTD PMID:36881089 Sox2 Rat sodium arsenate multiple interactions ISO SOX2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of SOX2 mRNA CTD PMID:32525701 Sox2 Rat sodium arsenite multiple interactions ISO SOX2 (Homo sapiens) 6480464 MIR155 mRNA affects the reaction [sodium arsenite results in increased expression of SOX2 protein] more ... CTD PMID:23219847 and PMID:29240254 Sox2 Rat sodium arsenite affects expression ISO SOX2 (Homo sapiens) 6480464 sodium arsenite affects the expression of SOX2 mRNA CTD PMID:29319823 Sox2 Rat sodium arsenite increases expression ISO Sox2 (Mus musculus) 6480464 sodium arsenite results in increased expression of SOX2 mRNA CTD PMID:26438402 Sox2 Rat sodium arsenite decreases expression ISO Sox2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SOX2 mRNA and sodium arsenite results in decreased expression of SOX2 protein CTD PMID:23143138 and PMID:28370166 Sox2 Rat sodium arsenite multiple interactions ISO Sox2 (Mus musculus) 6480464 [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with sodium arsenite] results in decreased expression of SOX2 protein more ... CTD PMID:23143138 and PMID:26438402 Sox2 Rat sodium arsenite increases expression ISO SOX2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SOX2 mRNA and sodium arsenite results in increased expression of SOX2 protein CTD PMID:23219847 more ... Sox2 Rat sterigmatocystin decreases expression EXP 6480464 Sterigmatocystin results in decreased expression of SOX2 mRNA CTD PMID:34126181 Sox2 Rat Tanshinone I multiple interactions EXP 6480464 tanshinone inhibits the reaction [Estrogens deficiency results in decreased expression of SOX2 protein] CTD PMID:31108107 Sox2 Rat Tanshinone I increases expression ISO Sox2 (Mus musculus) 6480464 tanshinone results in increased expression of SOX2 mRNA CTD PMID:25186638 Sox2 Rat taurocholic acid increases expression ISO Sox2 (Mus musculus) 6480464 Taurocholic Acid results in increased expression of SOX2 mRNA CTD PMID:27151938 Sox2 Rat temozolomide increases expression ISO SOX2 (Homo sapiens) 6480464 Temozolomide results in increased expression of SOX2 mRNA CTD PMID:31758290 Sox2 Rat terbufos increases methylation ISO SOX2 (Homo sapiens) 6480464 terbufos results in increased methylation of SOX2 promoter CTD PMID:22847954 Sox2 Rat Tetrachlorobisphenol A increases expression ISO SOX2 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of SOX2 mRNA CTD PMID:31326446 Sox2 Rat titanium dioxide decreases expression ISO Sox2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SOX2 mRNA CTD PMID:23557971 Sox2 Rat titanium dioxide decreases expression ISO SOX2 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of SOX2 mRNA CTD PMID:34973136 Sox2 Rat titanium dioxide decreases methylation ISO Sox2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SOX2 gene and titanium dioxide results in decreased methylation of SOX2 promoter CTD PMID:35295148 Sox2 Rat trametinib multiple interactions ISO SOX2 (Homo sapiens) 6480464 [trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of SOX2 protein and XAV939 inhibits the reaction [[trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of SOX2 protein] CTD PMID:37116855 Sox2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SOX2 mRNA CTD PMID:33387578 Sox2 Rat trichostatin A decreases expression ISO SOX2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SOX2 mRNA CTD PMID:24935251 and PMID:26272509 Sox2 Rat trichostatin A multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat triclosan decreases expression ISO Sox2 (Mus musculus) 6480464 Triclosan results in decreased expression of SOX2 protein CTD PMID:24879426 Sox2 Rat triphenyl phosphate decreases expression ISO Sox2 (Mus musculus) 6480464 triphenyl phosphate results in decreased expression of SOX2 mRNA CTD PMID:35752650 Sox2 Rat Triptolide multiple interactions ISO SOX2 (Homo sapiens) 6480464 triptolide inhibits the reaction [cobaltous chloride results in increased expression of SOX2 protein] CTD PMID:24842335 Sox2 Rat Tungsten carbide multiple interactions ISO SOX2 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in decreased expression of SOX2 mRNA CTD PMID:20105288 Sox2 Rat urethane decreases expression ISO SOX2 (Homo sapiens) 6480464 Urethane results in decreased expression of SOX2 mRNA CTD PMID:28818685 Sox2 Rat valproic acid decreases methylation ISO SOX2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SOX2 gene CTD PMID:29154799 Sox2 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SOX2 mRNA CTD PMID:33150595 Sox2 Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of SOX2 promoter CTD PMID:33150595 Sox2 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of SOX2 mRNA CTD PMID:29427782 Sox2 Rat valproic acid multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat valproic acid decreases expression ISO SOX2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SOX2 mRNA CTD PMID:23179753 more ... Sox2 Rat vanadyl sulfate decreases expression ISO SOX2 (Homo sapiens) 6480464 vanadyl sulfate results in decreased expression of SOX2 mRNA CTD PMID:16330358 Sox2 Rat verapamil multiple interactions ISO SOX2 (Homo sapiens) 6480464 [Verapamil co-treated with kaempferol] results in decreased expression of SOX2 mRNA CTD PMID:35063459 Sox2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SOX2 mRNA CTD PMID:18042343 Sox2 Rat vorinostat decreases expression ISO SOX2 (Homo sapiens) 6480464 vorinostat results in decreased expression of SOX2 mRNA CTD PMID:26272509 Sox2 Rat vorinostat multiple interactions ISO SOX2 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SOX2 mRNA CTD PMID:27188386 Sox2 Rat XAV939 multiple interactions ISO SOX2 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of SOX2 mRNA more ... CTD PMID:34480604 and PMID:37116855 Sox2 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of SOX2 protein] CTD PMID:35841924 Sox2 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of SOX2 protein] CTD PMID:35841924 Sox2 Rat zoledronic acid increases expression ISO SOX2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SOX2 mRNA CTD PMID:24714768
(20S)-ginsenoside Rg3 (ISO) (R)-pantothenic acid (ISO) (S)-naringenin (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 3-methyladenine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (EXP) 5-fluorouracil (ISO) 6-bromoindirubin-3'-oxime (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) acrylamide (ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) Anatoxin a (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antirheumatic drug (ISO) Antrocin (ISO) apigenin (ISO) Aroclor 1254 (EXP) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aspartame (ISO) azithromycin (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bromochloroacetic acid (ISO) buta-1,3-diene (ISO) butanal (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) carbofuran (EXP) carbon atom (ISO) carbon nanotube (ISO) carboplatin (ISO) carvedilol (EXP,ISO) celecoxib (ISO) CGP 52608 (ISO) CHIR 99021 (ISO) chlordecone (ISO) chloroprene (ISO) chlorpromazine (ISO) chromium(6+) (ISO) chrysene (ISO) ciprofloxacin (ISO) cisplatin (ISO) Citreoviridin (ISO) cobalt atom (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) cordycepin (ISO) cortisol (ISO) crystal violet (ISO) Cuprizon (EXP) curcumin (ISO) D-glucose (ISO) decabromodiphenyl ether (EXP,ISO) dehydroepiandrosterone (ISO) deoxycholic acid (ISO) dexamethasone (EXP,ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) diethylstilbestrol (EXP) dioxygen (ISO) dorsomorphin (ISO) eckol (ISO) elemental carbon (ISO) ethanol (EXP) etodolac (ISO) etoposide (ISO) fluoxetine (ISO) flurbiprofen (ISO) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) gemcitabine (ISO) genistein (ISO) glucose (ISO) glycerol 2-phosphate (ISO) GS-441524 (ISO) hexachlorophene (ISO) hydroquinone (ISO) Indeno[1,2,3-cd]pyrene (ISO) isoorientin (ISO) ivermectin (ISO) kaempferol (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lapatinib (ISO) lead diacetate (ISO) lupeol (ISO) LY294002 (ISO) mercury dibromide (ISO) methimazole (EXP) methylmercury chloride (ISO) methylparaben (ISO) miconazole (ISO) naphthalene (ISO) nickel dichloride (ISO) Nonylphenol (EXP,ISO) ochratoxin A (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) poly(I:C) (ISO) PRIM-O-GLUCOSYLCIMIFUGIN (EXP) prostaglandin E2 (ISO) quercetin (ISO) remdesivir (ISO) resveratrol (ISO) S-nitrosoglutathione (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sirtinol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sterigmatocystin (EXP) Tanshinone I (EXP,ISO) taurocholic acid (ISO) temozolomide (ISO) terbufos (ISO) Tetrachlorobisphenol A (ISO) titanium dioxide (ISO) trametinib (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) Triptolide (ISO) Tungsten carbide (ISO) urethane (ISO) valproic acid (EXP,ISO) vanadyl sulfate (ISO) verapamil (ISO) vinclozolin (EXP) vorinostat (ISO) XAV939 (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (ISO)
Biological Process
adenohypophysis development (IEP,ISO) anatomical structure formation involved in morphogenesis (ISO) brain development (IBA) cell fate commitment (ISO) cell fate specification (ISO) cellular response to cadmium ion (ISO) cellular response to hypoxia (IEP) cerebral cortex development (ISO) detection of mechanical stimulus involved in equilibrioception (ISO) detection of mechanical stimulus involved in sensory perception of sound (ISO) diencephalon morphogenesis (ISO) embryonic organ development (ISO) endodermal cell fate specification (IEA,ISO) epithelial tube branching involved in lung morphogenesis (ISO) eye development (IEA,ISO) forebrain development (IBA,IEA,ISO) forebrain neuron differentiation (ISO) gene expression (ISO) inner ear development (IBA,IEA,ISO) inner ear morphogenesis (ISO) lens induction in camera-type eye (ISO) lung alveolus development (ISO) male genitalia development (ISO) negative regulation of canonical Wnt signaling pathway (IEA,ISO) negative regulation of cell cycle G1/S phase transition (IEA,ISO) negative regulation of cell differentiation (ISO) negative regulation of neuron differentiation (ISO) negative regulation of osteoblast differentiation (ISO) negative regulation of transcription by RNA polymerase II (IBA,ISO) negative regulation of Wnt signaling pathway (ISO) neuroblast proliferation (ISO) neuron differentiation (IBA,ISO) neuron fate commitment (ISO) neuronal stem cell population maintenance (ISO) Notch signaling pathway (ISO) olfactory placode formation (ISO) osteoblast differentiation (IEA,ISO) pigment biosynthetic process (ISO) pituitary gland development (IEA,ISO) positive regulation of cell differentiation (IMP) positive regulation of cell-cell adhesion (IMP) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of epithelial cell differentiation (ISO) positive regulation of MAPK cascade (IEA,ISO) positive regulation of neuroblast proliferation (ISO) positive regulation of neuron differentiation (ISO) positive regulation of Notch signaling pathway (ISO) positive regulation of transcription by RNA polymerase II (IBA,IDA,IEA,ISO) regulation of DNA-templated transcription (IEA,ISO) regulation of gene expression (IEA,ISO) regulation of myofibroblast cell apoptotic process (IMP) regulation of neurogenesis (ISO) regulation of transcription by RNA polymerase II (ISO) response to ethanol (IEP) response to growth factor (IEA,ISO) response to oxygen-glucose deprivation (IMP) response to retinoic acid (ISO) response to wounding (IEA,ISO) retina morphogenesis in camera-type eye (ISO) sensory perception of sound (ISO) somatic stem cell population maintenance (IEA,ISO) stem cell differentiation (ISO) stem cell population maintenance (ISO) tissue regeneration (IEP) tongue development (ISO) trophectodermal cell differentiation (ISO) Wnt signaling pathway (ISO)
Molecular Function
chromatin binding (ISO) chromatin DNA binding (ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IBA,IDA) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (ISO) DNA-binding transcription factor binding (ISO) miRNA binding (IEA,ISO) nitric-oxide synthase binding (IPI) protein binding (IPI,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (ISO) sequence-specific DNA binding (IEA,ISO) transcription cis-regulatory region binding (IDA,IEA,ISO)
1.
The detrimental effects of diabetes on pluripotency determined by KLF4, SOX2, C-MYC and OCT4 immunoreactivity in rat testes.
Aktug H, etal., Adv Clin Exp Med. 2013 May-Jun;22(3):327-35.
2.
Immunohistochemical expression of SOX2 in vulvar intraepithelial neoplasia and squamous cell carcinoma.
Brustmann H and Brunner A, Int J Gynecol Pathol. 2013 May;32(3):323-8. doi: 10.1097/PGP.0b013e31825d820e.
3.
Sorafenib Alleviates Inflammatory Signaling of Tumor Microenvironment in Precancerous Lung Injuries.
Cicek B, etal., Pharmaceuticals (Basel). 2023 Feb 1;16(2):221. doi: 10.3390/ph16020221.
4.
Sox2 nuclear expression is closely associated with poor prognosis in patients with histologically node-negative oral tongue squamous cell carcinoma.
Du L, etal., Oral Oncol. 2011 Aug;47(8):709-13. doi: 10.1016/j.oraloncology.2011.05.017.
5.
Mutations in SOX2 cause anophthalmia.
Fantes J, etal., Nat Genet. 2003 Apr;33(4):461-3. Epub 2003 Mar 3.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Maternally Expressed Gene 3 (MEG3) Enhances PC12 Cell Hypoxia Injury by Targeting MiR-147.
Han L, etal., Cell Physiol Biochem. 2017;43(6):2457-2469. doi: 10.1159/000484452. Epub 2017 Oct 31.
8.
Increased SOX2 expression in less differentiated breast carcinomas and their lymph node metastases.
Huang YH, etal., Histopathology. 2014 Mar;64(4):494-503. doi: 10.1111/his.12257. Epub 2013 Nov 28.
9.
Prognostic impact of the expression of ALDH1 and SOX2 in urothelial cancer of the upper urinary tract.
Kitamura H, etal., Mod Pathol. 2013 Jan;26(1):117-24. doi: 10.1038/modpathol.2012.139. Epub 2012 Aug 17.
10.
Sox2 in the adult rat sensory nervous system.
Koike T, etal., Histochem Cell Biol. 2014 Mar;141(3):301-9. doi: 10.1007/s00418-013-1158-x. Epub 2013 Oct 31.
11.
SOX2 and nestin expression in human melanoma: an immunohistochemical and experimental study.
Laga AC, etal., Exp Dermatol. 2011 Apr;20(4):339-45. doi: 10.1111/j.1600-0625.2011.01247.x.
12.
SOX2 expression is upregulated in adult spinal cord after contusion injury in both oligodendrocyte lineage and ependymal cells.
Lee HJ, etal., J Neurosci Res. 2013 Feb;91(2):196-210. doi: 10.1002/jnr.23151. Epub 2012 Nov 21.
13.
Sox2 expression in breast tumours and activation in breast cancer stem cells.
Leis O, etal., Oncogene. 2012 Mar 15;31(11):1354-65. doi: 10.1038/onc.2011.338. Epub 2011 Aug 8.
14.
Combined class I histone deacetylase and mTORC1/C2 inhibition suppresses the initiation and recurrence of oral squamous cell carcinomas by repressing SOX2.
Liang X, etal., Cancer Lett. 2019 Jul 10;454:108-119. doi: 10.1016/j.canlet.2019.04.010. Epub 2019 Apr 11.
15.
Identification of key genes and pathways associated with cholangiocarcinoma development based on weighted gene correlation network analysis.
Liu J, etal., PeerJ. 2019 Oct 31;7:e7968. doi: 10.7717/peerj.7968. eCollection 2019.
16.
Morphologic and histopathologic change of sodium iodate-induced retinal degeneration in adult rats.
Liu Y, etal., Int J Clin Exp Pathol. 2019 Feb 1;12(2):443-454. eCollection 2019.
17.
Novel SOX2 partner-factor domain mutation in a four-generation family.
Mihelec M, etal., Eur J Hum Genet. 2009 Nov;17(11):1417-22. doi: 10.1038/ejhg.2009.79. Epub 2009 May 27.
18.
A role for SOX2 in the generation of microtubule-associated protein 2-positive cells from microglia.
Nonaka H, etal., Biochem Biophys Res Commun. 2009 Feb 27;380(1):60-4. doi: 10.1016/j.bbrc.2009.01.027. Epub 2009 Jan 20.
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
EphB signaling directs peripheral nerve regeneration through Sox2-dependent Schwann cell sorting.
Parrinello S, etal., Cell. 2010 Oct 1;143(1):145-55. doi: 10.1016/j.cell.2010.08.039.
21.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
23.
Comprehensive gene review and curation
RGD comprehensive gene curation
24.
Novel SOX2 mutations and genotype-phenotype correlation in anophthalmia and microphthalmia.
Schneider A, etal., Am J Med Genet A. 2009 Dec;149A(12):2706-15. doi: 10.1002/ajmg.a.33098.
25.
Sex determining region Y-box 2 (SOX2) amplification is an independent indicator of disease recurrence in sinonasal cancer.
Schrock A, etal., PLoS One. 2013;8(3):e59201. doi: 10.1371/journal.pone.0059201. Epub 2013 Mar 27.
26.
Alcohol-induced cognitive deficits are associated with decreased circulating levels of the neurotrophin BDNF in humans and rats.
Silva-Peña D, etal., Addict Biol. 2019 Sep;24(5):1019-1033. doi: 10.1111/adb.12668. Epub 2018 Sep 12.
27.
Expression and role of Oct3/4, Nanog and Sox2 in regeneration of rat tracheal epithelium.
Song N, etal., Cell Prolif. 2010 Feb;43(1):49-55. doi: 10.1111/j.1365-2184.2009.00653.x. Epub 2009 Oct 21.
28.
Targeted silencing of the oncogenic transcription factor SOX2 in breast cancer.
Stolzenburg S, etal., Nucleic Acids Res. 2012 Aug;40(14):6725-40. Epub 2012 May 4.
29.
SOX2 autoantibodies as noninvasive serum biomarker for breast carcinoma.
Sun Y, etal., Cancer Epidemiol Biomarkers Prev. 2012 Nov;21(11):2043-7. doi: 10.1158/1055-9965.EPI-12-0498. Epub 2012 Jul 25.
30.
Sox2 controls Schwann cell self-organization through fibronectin fibrillogenesis.
Torres-Mejía E, etal., Sci Rep. 2020 Feb 6;10(1):1984. doi: 10.1038/s41598-019-56877-y.
31.
Long Non-Coding RNA SOX2 Overlapping Transcript Aggravates H9c2 Cell Injury via the miR-215-5p/ZEB2 Axis and Promotes Ischemic Heart Failure in a Rat Model.
Tu J, etal., Tohoku J Exp Med. 2021 Jul;254(3):221-231. doi: 10.1620/tjem.254.221.
32.
Identification of novel domains within Sox-2 and Sox-11 involved in autoinhibition of DNA binding and partnership specificity.
Wiebe MS, etal., J Biol Chem. 2003 May 16;278(20):17901-11. Epub 2003 Mar 10.
33.
Significant quantitative and qualitative transition in pituitary stem / progenitor cells occurs during the postnatal development of the rat anterior pituitary.
Yoshida S, etal., J Neuroendocrinol. 2011 Oct;23(10):933-43. doi: 10.1111/j.1365-2826.2011.02198.x.
34.
nNOS Translocates into the Nucleus and Interacts with Sox2 to Protect Neurons Against Early Excitotoxicity via Promotion of Shh Transcription.
Zhang D, etal., Mol Neurobiol. 2016 Nov;53(9):6444-6458. doi: 10.1007/s12035-015-9545-z. Epub 2015 Nov 25.
35.
Effects of acupuncture on cortical expression of Wnt3a, β-catenin and Sox2 in a rat model of traumatic brain injury.
Zhang YM, etal., Acupunct Med. 2016 Feb;34(1):48-54. doi: 10.1136/acupmed-2014-010742. Epub 2015 Aug 21.
36.
Sox2 Sustains Recruitment of Oligodendrocyte Progenitor Cells following CNS Demyelination and Primes Them for Differentiation during Remyelination.
Zhao C, etal., J Neurosci. 2015 Aug 19;35(33):11482-99. doi: 10.1523/JNEUROSCI.3655-14.2015.
Sox2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 119,465,131 - 119,467,542 (+) NCBI GRCr8 mRatBN7.2 2 117,536,929 - 117,539,340 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 117,536,929 - 117,539,338 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 124,123,587 - 124,125,999 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 122,236,249 - 122,238,661 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 116,863,148 - 116,865,560 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 121,165,137 - 121,167,545 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 121,165,137 - 121,167,545 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 140,810,593 - 140,813,001 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 120,969,021 - 120,971,430 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 112,569,723 - 112,572,132 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
SOX2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 181,711,925 - 181,714,436 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 181,711,925 - 181,714,436 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 181,429,713 - 181,432,224 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 182,912,416 - 182,914,918 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 182,912,423 - 182,914,923 NCBI Celera 3 179,863,407 - 179,865,909 (+) NCBI Celera Cytogenetic Map 3 q26.33 NCBI HuRef 3 178,834,536 - 178,837,048 (+) NCBI HuRef CHM1_1 3 181,392,587 - 181,395,099 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 184,516,501 - 184,519,012 (+) NCBI T2T-CHM13v2.0
Sox2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 34,704,144 - 34,706,610 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 34,704,554 - 34,706,610 (+) Ensembl GRCm39 Ensembl GRCm38 3 34,649,995 - 34,652,461 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 34,650,405 - 34,652,461 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 34,548,927 - 34,551,383 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 34,841,604 - 34,844,008 (+) NCBI MGSCv36 mm8 Celera 3 34,551,711 - 34,554,169 (+) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 16.93 NCBI
Sox2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 10,671,978 - 10,672,934 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 10,671,888 - 10,674,080 (+) NCBI ChiLan1.0 ChiLan1.0
SOX2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 179,580,390 - 179,582,909 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 179,585,108 - 179,587,627 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 178,744,881 - 178,747,392 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 186,922,223 - 186,924,785 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 186,922,705 - 186,923,662 (+) Ensembl panpan1.1 panPan2
SOX2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 14,853,000 - 14,855,153 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 18,934,171 - 18,936,303 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 14,755,806 - 14,757,946 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 34 14,797,347 - 14,799,478 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 14,782,119 - 14,784,242 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 15,026,650 - 15,028,779 (+) NCBI UU_Cfam_GSD_1.0
Sox2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 111,588,129 - 111,590,044 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936566 1,631,822 - 1,632,613 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936566 1,630,698 - 1,632,607 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SOX2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 119,668,476 - 119,669,435 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 119,668,476 - 119,669,435 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 128,979,657 - 128,980,616 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 13 q23-q41 NCBI
SOX2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 7,673,581 - 7,676,812 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 7,674,867 - 7,675,826 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 16,496,978 - 16,500,141 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sox2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 260 Count of miRNA genes: 184 Interacting mature miRNAs: 201 Transcripts: ENSRNOT00000016236 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1598865 Bp296 Blood pressure QTL 296 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 81018907 126018907 Rat 1578772 Stresp14 Stress response QTL 14 5 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 2 82345893 130923501 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 2300165 Bmd49 Bone mineral density QTL 49 4.8 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 2 88862519 133862519 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2300170 Bmd45 Bone mineral density QTL 45 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359035 Bp276 Blood pressure QTL 276 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 143657569 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 2300185 Bmd46 Bone mineral density QTL 46 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 88862519 133862519 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 61392 Bp6 Blood pressure QTL 6 7 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 2 80270434 125270434 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 7207808 Bmd89 Bone mineral density QTL 89 4.1 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 2 88862519 133862519 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
X94127
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,538,619 - 117,538,805 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,166,827 - 121,167,012 NCBI Rnor6.0 Rnor_5.0 2 140,812,283 - 140,812,468 UniSTS Rnor5.0 RGSC_v3.4 2 120,970,712 - 120,970,897 UniSTS RGSC3.4 Celera 2 112,571,414 - 112,571,599 UniSTS Cytogenetic Map 2 q25 UniSTS
Sox2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,537,291 - 117,538,251 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,165,500 - 121,166,459 NCBI Rnor6.0 Rnor_5.0 2 140,810,956 - 140,811,915 UniSTS Rnor5.0 RGSC_v3.4 2 120,969,384 - 120,970,343 UniSTS RGSC3.4 Celera 2 112,570,086 - 112,571,045 UniSTS Cytogenetic Map 2 q25 UniSTS
UniSTS:471104
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,537,666 - 117,538,078 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,165,875 - 121,166,286 NCBI Rnor6.0 Rnor_5.0 2 140,811,331 - 140,811,742 UniSTS Rnor5.0 RGSC_v3.4 2 120,969,759 - 120,970,170 UniSTS RGSC3.4 Celera 2 112,570,461 - 112,570,872 UniSTS Cytogenetic Map 2 q25 UniSTS
PMC304100P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,537,871 - 117,537,993 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,166,080 - 121,166,201 NCBI Rnor6.0 Rnor_5.0 2 140,811,536 - 140,811,657 UniSTS Rnor5.0 RGSC_v3.4 2 120,969,964 - 120,970,085 UniSTS RGSC3.4 Celera 2 112,570,666 - 112,570,787 UniSTS Cytogenetic Map 2 q25 UniSTS
Sox2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,538,991 - 117,539,176 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,167,199 - 121,167,383 NCBI Rnor6.0 Rnor_5.0 2 140,812,655 - 140,812,839 UniSTS Rnor5.0 RGSC_v3.4 2 120,971,084 - 120,971,268 UniSTS RGSC3.4 Celera 2 112,571,786 - 112,571,970 UniSTS Cytogenetic Map 2 q25 UniSTS
Sox2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,538,902 - 117,539,232 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,167,110 - 121,167,439 NCBI Rnor6.0 Rnor_5.0 2 140,812,566 - 140,812,895 UniSTS Rnor5.0 RGSC_v3.4 2 120,970,995 - 120,971,324 UniSTS RGSC3.4 Celera 2 112,571,697 - 112,572,026 UniSTS Cytogenetic Map 2 q25 UniSTS
Sox2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,537,481 - 117,537,685 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,165,690 - 121,165,893 NCBI Rnor6.0 Rnor_5.0 2 140,811,146 - 140,811,349 UniSTS Rnor5.0 RGSC_v3.4 2 120,969,574 - 120,969,777 UniSTS RGSC3.4 Celera 2 112,570,276 - 112,570,479 UniSTS Cytogenetic Map 2 q25 UniSTS
Sox2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 117,537,801 - 117,537,932 (+) MAPPER mRatBN7.2 Rnor_6.0 2 121,166,010 - 121,166,140 NCBI Rnor6.0 Rnor_5.0 2 140,811,466 - 140,811,596 UniSTS Rnor5.0 RGSC_v3.4 2 120,969,894 - 120,970,024 UniSTS RGSC3.4 Celera 2 112,570,596 - 112,570,726 UniSTS Cytogenetic Map 2 q25 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
33
112
50
50
20
19
20
6
133
72
93
24
55
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016236 ⟹ ENSRNOP00000016236
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 117,536,929 - 117,539,338 (+) Ensembl Rnor_6.0 Ensembl 2 121,165,137 - 121,167,545 (+) Ensembl
RefSeq Acc Id:
NM_001109181 ⟹ NP_001102651
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 119,465,131 - 119,467,542 (+) NCBI mRatBN7.2 2 117,536,929 - 117,539,340 (+) NCBI Rnor_6.0 2 121,165,137 - 121,167,545 (+) NCBI Rnor_5.0 2 140,810,593 - 140,813,001 (+) NCBI RGSC_v3.4 2 120,969,021 - 120,971,430 (+) RGD Celera 2 112,569,723 - 112,572,132 (+) RGD
Sequence:
GTGTTTGCAAAAAGGGAAAAGTACTTTGCTGCCTCTTTAAGACTAGGGCTGGGAGAAAGAAGAGGAGAGAAAAAGAAAGGAGAGAAGTTTGGAGCCCGAGGCTTAAGCCTTTCCAAAAACTAATCACA ACAATCGCGGCGGCCCGAGGAGGAGAGCGACTGTTTTTTCATCCCAATTGCACTTCGCCCGTCTCGAGCTCCGCTTCCCCCCAACTATTCTCCGCCAGATCTCCGCGCAAGGCCGTGCACGCCGACGA CCCCGCCCGCGGCCCCTGCATCCCGGCCCCCGCGCGCGGCCCCCGCAGTCCCGGCCGGGCCGAGGGTCGGCGGCCGCCGGCGGGCCGCGCCCGCGCCCAGCGCCCGCATGTATAACATGATGGAGACG GAGCTGAAGCCGCCGGGCCCTCAGCAAGCTTCGGGGGGCGGCGGCGGAGGAGGCAACGCCACGGCGGCGGCGACCGGCGGCAACCAGAAGAACAGCCCGGACCGCGTCAAGAGGCCCATGAATGCCTT CATGGTGTGGTCCCGGGGGCAGCGGCGTAAGATGGCCCAGGAGAACCCCAAGATGCACAACTCGGAGATCAGCAAGCGCCTGGGCGCCGAGTGGAAACTTTTGTCGGAGACCGAGAAGCGGCCGTTCA TCGACGAGGCCAAGCGGCTGCGCGCTCTGCACATGAAGGAGCACCCGGATTATAAATACCGGCCGCGGCGGAAAACCAAGACGCTCATGAAGAAGGATAAGTACACGCTTCCCGGAGGCTTGCTGGCC CCCGGCGGGAACAGCATGGCGAGCGGGGTTGGGGTGGGCGCCGGCCTGGGTGCGGGCGTGAACCAGCGCATGGACAGCTACGCGCACATGAACGGCTGGAGCAACGGCAGCTACAGCATGATGCAGGA GCAGCTGGGCTACCCGCAGCACCCGGGCCTCAACGCTCACGGCGCGGCACAGATGCAGCCGATGCACCGCTACGACGTCAGCGCCCTGCAGTACAACTCCATGACCAGCTCGCAGACCTACATGAACG GCTCGCCCACCTACAGCATGTCCTACTCGCAGCAGGGCACCCCCGGTATGGCGCTGGGCTCCATGGGCTCTGTGGTCAAGTCCGAGGCCAGTTCCAGCCCCCCCGTGGTTACCTCTTCCTCCCACTCC AGGGCGCCCTGCCAGGCCGGGGACCTCCGGGACATGATCAGCATGTACCTCCCCGGCGCCGAGGTGCCGGAGCCCGCTGCGCCCAGTAGACTGCACATGGCCCAGCACTACCAGAGCGGCCCGGTGCC CGGCACGGCCATTAACGGCACACTGCCCCTGTCGCACATGTGAGGGCCGGACCGCGAACTGGAGAAGGGGAGAGATTTTTCAAAAAGATACAAGGGAATTGGGAGGGGTGCAAAAGAGGAGAGTAAGA AAAATCTGAATGCTCAAAAGGAAAAAAAAAATCTCATTACCCGCAGCAAAATGACAGCTGCGGAAAAAAACCACCAATCCCATCCAAATTAACGCAAAAACCGTGATGCCGACTAGAAAACTTTTATG AGAGATCTGGAGGAAAAAAACTACGCAAAACTTTTTTTTAAAGTTCTAGTGGTACGTTAGGCGCTTCGCAGGGAGTTCTCAAAAGTCTTTACCAGTAATATTTAGAACTAGACTCCGGGCGATGAAAA AAGTTTTAATATTTGCAAGCAACTTTTGTACAGTATTTATCGAGATAAACATGGCAATCAAATGTCCATTGTTTATAAGCTGAGAATTTGCCAATATTTTTCGAGGAAAGGGTTCTTGCTGGGTTTTG ATTCTGCAGCTTAAATTAAGGACCGTTACAGACAAGGAAGGAATTTATTCGGATTTGAACGTTTTAGTTTTAAAATTGTACAAAAGGAAAACATGAGAGCAAGTACTGGCAAGACCATTTTCGTGGTC TTGTTTAGGGCAAACGTTCTAGATTGTACTAAATTTTTAACTTACTGTTAAAGGCAAAAAAAAAATGTCCATGCAGGTTGATATCGTTGGTAATTTATAATAGCTTTTGTTCAATCCCACCCTTTTCA TTTTGTTCACATAAAAATATGGAAATTACTGTGTTTGAAATATTTTCTTATGGTTTGTAATATTTCTGTAAATTGTGATATTTTAAGGTTTTTTCCCCCTTTTATTTTCCGTAGTTGTATTTTAAAAG ATTCGGCTGTTATTGGAACCAGGCTGCCGAGAATCCATGTATATATTTGAACTAATACCATCCTTATAACAGTTACGTTTCCAACTTAAGTTTTTACTCCATTATGCACAGTTTGAGATAAATAAATT TTTGAAATATGGACACTGA
hide sequence
RefSeq Acc Id:
NP_001102651 ⟸ NM_001109181
- UniProtKB:
D4A543 (UniProtKB/TrEMBL), A6IHU9 (UniProtKB/TrEMBL)
- Sequence:
MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYT LPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPV VTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAINGTLPLSHM
hide sequence
Ensembl Acc Id:
ENSRNOP00000016236 ⟸ ENSRNOT00000016236
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-08-05
Sox2
SRY-box transcription factor 2
Sox2
SRY box 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2015-11-12
Sox2
SRY box 2
Sox2
SRY (sex determining region Y)-box 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2015-07-29
Sox2
SRY (sex determining region Y)-box 2
LOC100912162
uncharacterized LOC100912162
Data merged from RGD:6488815
737654
PROVISIONAL
2012-07-05
LOC100912162
uncharacterized LOC100912162
Symbol and Name status set to provisional
70820
PROVISIONAL
2008-09-18
Sox2
SRY (sex determining region Y)-box 2
Sox2
SRY-box containing gene 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-07
Sox2
SRY-box containing gene 2
RGD1565646_predicted
similar to SOX2 protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-07
RGD1565646_predicted
similar to SOX2 protein (predicted)
LOC499593
similar to SOX2 protein
Symbol and Name status set to approved
1299863
APPROVED
2006-02-09
LOC499593
similar to SOX2 protein
Symbol and Name status set to provisional
70820
PROVISIONAL