Advanced Search (OLGA)

Gene: Hoxa11 (homeobox A11) Rattus norvegicus

Analyze

Symbol:

Hoxa11

Name:

homeobox A11

RGD ID:

1564605

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in prostate gland development; response to estrogen; and response to testosterone. Predicted to be located in nucleoplasm. Predicted to be part of protein-DNA complex and transcription regulator complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in radioulnar synostosis. Orthologous to human HOXA11 (homeobox A11); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

homeo box A10; homeobox protein A10; homeobox protein Hox-A11; homeobox protein Hox-A11-like; Hoxa10; LOC100909443; LOC368057; LOC500127; MGC188427; RGD1564605; RGD1566402; similar to homeobox protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HOXA11 (homeobox A11)	RGD	RGD
Mus musculus (house mouse):	Hoxa11 (homeobox A11)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Hoxa11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HOXA11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HOXA11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hoxa11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HOXA11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HOXA11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hoxa11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Hoxa11 (homeobox A11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	HOXA11 (homeobox A11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hoxa11 (homeobox A11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hoxa11b (homeobox A11b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hoxa11b (homeobox A11b)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hoxa11a (homeobox A11a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	hoxa11a (homeobox A11a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Abd-B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	Abd-B	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Caenorhabditis elegans (roundworm):	php-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	hoxa11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hoxa11	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	82,673,139 - 82,676,801 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	82,673,140 - 82,676,844 (-)	Ensembl				GRCr8
mRatBN7.2	4	81,342,527 - 81,346,189 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	81,342,528 - 81,346,232 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	86,564,339 - 86,567,995 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	82,339,730 - 82,343,386 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	80,766,832 - 80,770,490 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	82,296,888 - 82,301,419 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	82,211,366 - 82,215,022 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	4	82,298,152 - 82,300,503 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	146,963,720 - 146,967,382 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	80,542,417 - 80,546,079	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	76,233,120 - 76,236,782 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Congenital Limb Deformities (ISO)

Contracture (ISO)

Desbuquois dysplasia (ISO)

Endometrial Neoplasms (ISO)

Female Urogenital Diseases (ISO)

hemorrhagic disease (ISO)

kidney disease (ISO)

Kyphoscoliosis (IEP)

osteochondrodysplasia (ISO)

radioulnar synostosis (ISO)

Radioulnar Synostosis with Amegakaryocytic Thrombocytopenia (ISO)

Radioulnar Synostosis with Amegakaryocytic Thrombocytopenia 1 (ISO)

Urogenital Abnormalities (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-hydroperoxycyclophosphamide (ISO)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amosite asbestos (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bortezomib (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

choline (ISO)

cobalt dichloride (EXP)

corn oil (ISO)

crocidolite asbestos (ISO)

diethylstilbestrol (EXP,ISO)

dimethoate (EXP)

estriol (ISO)

folic acid (ISO)

genistein (ISO)

L-methionine (ISO)

medroxyprogesterone acetate (ISO)

methotrexate (ISO)

Monobutylphthalate (EXP)

nitrogen dioxide (ISO)

perfluorohexanesulfonic acid (ISO)

phytoestrogen (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

progesterone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

testosterone (EXP,ISO)

titanium dioxide (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterior/posterior pattern specification (ISO)

bone development (ISO)

branching involved in ureteric bud morphogenesis (ISO)

cartilage development involved in endochondral bone morphogenesis (ISO)

developmental growth (ISO)

DNA-templated transcription (IEA)

dorsal/ventral pattern formation (ISO)

embryonic digit morphogenesis (IEA,ISO)

embryonic forelimb morphogenesis (ISO)

embryonic limb morphogenesis (ISO)

embryonic skeletal joint morphogenesis (IBA,IEA,ISO)

male gonad development (ISO)

mesodermal cell fate specification (IEA,ISO)

metanephros development (IEA,ISO)

organ induction (IEA,ISO)

positive regulation of cell development (ISO)

positive regulation of chondrocyte differentiation (ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

prostate gland development (IEP)

proximal/distal pattern formation (IEA,ISO)

regulation of chondrocyte differentiation (ISO)

regulation of DNA-templated transcription (IEA)

regulation of gene expression (ISO)

regulation of transcription by RNA polymerase II (IBA)

response to estrogen (IEP)

response to testosterone (IEP)

single fertilization (ISO)

skeletal system development (ISO)

spermatogenesis (ISO)

uterus development (ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA)

protein-containing complex (IEA,ISO)

protein-DNA complex (IEA,ISO)

transcription regulator complex (IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Posterior Hox gene expression and differential androgen regulation in the developing and adult rat prostate lobes.	Huang L, etal., Endocrinology. 2007 Mar;148(3):1235-45. Epub 2006 Nov 30.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Abnormalities of vertebral formation and Hox expression in congenital kyphoscoliotic rats.	Seki T, etal., Mol Cell Biochem. 2008 May;312(1-2):193-9. doi: 10.1007/s11010-008-9734-4. Epub 2008 Mar 9.
8.	Amegakaryocytic thrombocytopenia and radio-ulnar synostosis are associated with HOXA11 mutation.	Thompson AA and Nguyen LT, Nat Genet. 2000 Dec;26(4):397-8.
9.	Developmental exposure to Bisphenol a impairs the uterine response to ovarian steroids in the adult.	Varayoud J, etal., Endocrinology. 2008 Nov;149(11):5848-60. doi: 10.1210/en.2008-0651. Epub 2008 Jul 24.

Additional References at PubMed

PMID:7596412	PMID:7702549	PMID:7789268	PMID:9343407	PMID:11493536	PMID:11900456	PMID:12050119	PMID:12477932	PMID:12869760	PMID:14668414	PMID:15057822	PMID:15632090
PMID:17785448	PMID:18249394	PMID:18701816	PMID:20978074	PMID:22916278	PMID:23760953

Genomics

Comparative Map Data

Hoxa11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	82,673,139 - 82,676,801 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	82,673,140 - 82,676,844 (-)	Ensembl				GRCr8
mRatBN7.2	4	81,342,527 - 81,346,189 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	81,342,528 - 81,346,232 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	86,564,339 - 86,567,995 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	82,339,730 - 82,343,386 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	80,766,832 - 80,770,490 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	82,296,888 - 82,301,419 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	82,211,366 - 82,215,022 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	4	82,298,152 - 82,300,503 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	146,963,720 - 146,967,382 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	80,542,417 - 80,546,079	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	76,233,120 - 76,236,782 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

HOXA11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	27,181,157 - 27,185,232 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	27,181,157 - 27,185,232 (-)	Ensembl			hg38	GRCh38
GRCh37	7	27,220,776 - 27,224,851 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	27,187,301 - 27,191,360 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	26,994,368 - 26,998,070	NCBI
Celera	7	27,209,715 - 27,213,774 (-)	NCBI		Celera
Cytogenetic Map	7	p15.2	NCBI
HuRef	7	27,101,338 - 27,105,401 (-)	NCBI		HuRef
CHM1_1	7	27,220,497 - 27,224,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	27,317,166 - 27,321,240 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	27,271,961 - 27,276,020 (-)	NCBI

Hoxa11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	52,219,086 - 52,222,784 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	52,219,086 - 52,222,790 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	52,242,105 - 52,245,810 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	52,242,106 - 52,245,810 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	52,192,105 - 52,195,766 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	52,171,689 - 52,175,350 (-)	NCBI		MGSCv36	mm8
Celera	6	52,763,744 - 52,767,403 (-)	NCBI		Celera
Cytogenetic Map	6	B3	NCBI
cM Map	6	25.4	NCBI

Hoxa11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	28,877,055 - 28,879,465 (-)	Ensembl
ChiLan1.0	NW_004955410	28,875,780 - 28,879,643 (-)	NCBI	ChiLan1.0	ChiLan1.0

HOXA11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	32,010,718 - 32,018,056 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	80,335,092 - 80,339,154 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	27,826,003 - 27,829,757 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	27,426,602 - 27,429,092 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	27,424,759 - 27,429,103 (-)	Ensembl			panPan2	panpan1.1

HOXA11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	40,355,907 - 40,360,120 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	40,357,478 - 40,359,919 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	39,786,761 - 39,790,944 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	40,294,564 - 40,298,764 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	40,295,087 - 40,299,055 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	40,408,521 - 40,412,708 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	40,093,599 - 40,097,769 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	40,452,219 - 40,456,401 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hoxa11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	84,597,557 - 84,601,354 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	3,809,288 - 3,813,014 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	3,809,288 - 3,813,014 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HOXA11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	45,388,375 - 45,391,953 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	45,388,523 - 45,392,190 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	50,021,709 - 50,025,376 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HOXA11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	31,180,232 - 31,187,709 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	31,183,682 - 31,186,010 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	73,546,525 - 73,553,107 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hoxa11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	3,418,723 - 3,423,950 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624739	3,420,501 - 3,424,151 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hoxa11
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	88,816,578 - 88,820,420 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hoxa11
25 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	1182
Count of miRNA genes:	291
Interacting mature miRNAs:	371
Transcripts:	ENSRNOT00000010256, ENSRNOT00000071568
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
2317586	Eae25	Experimental allergic encephalomyelitis QTL 25	9.300000190734863		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	4	80213634	84338055	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	80216705	104243248	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	61041057	94638356	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58079875	92690793	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	63900458	88813920	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

Markers in Region

U20371

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,343,516 - 81,343,709 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,297,879 - 82,298,071	NCBI	Rnor6.0
Rnor_6.0	4	82,212,355 - 82,212,547	NCBI	Rnor6.0
Rnor_5.0	4	146,879,186 - 146,879,378	UniSTS	Rnor5.0
Rnor_5.0	4	146,964,710 - 146,964,902	UniSTS	Rnor5.0
RGSC_v3.4	4	80,543,407 - 80,543,599	UniSTS	RGSC3.4
Celera	4	76,234,110 - 76,234,302	UniSTS
Cytogenetic Map	4	q24	UniSTS

D7S2774

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,332,478 - 81,332,819 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,286,842 - 82,287,182	NCBI	Rnor6.0
Rnor_6.0	4	82,201,047 - 82,201,387	NCBI	Rnor6.0
Rnor_5.0	4	146,867,878 - 146,868,218	UniSTS	Rnor5.0
Rnor_5.0	4	146,953,673 - 146,954,013	UniSTS	Rnor5.0
RGSC_v3.4	4	80,532,370 - 80,532,710	UniSTS	RGSC3.4
Celera	4	76,223,112 - 76,223,452	UniSTS
Cytogenetic Map	4	q24	UniSTS

AA893141

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,332,690 - 81,332,897 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,287,054 - 82,287,260	NCBI	Rnor6.0
Rnor_6.0	4	82,201,259 - 82,201,465	NCBI	Rnor6.0
Rnor_5.0	4	146,953,885 - 146,954,091	UniSTS	Rnor5.0
Rnor_5.0	4	146,868,090 - 146,868,296	UniSTS	Rnor5.0
RGSC_v3.4	4	80,532,582 - 80,532,788	UniSTS	RGSC3.4
Celera	4	76,223,324 - 76,223,530	UniSTS
RH 3.4 Map	4	513.31	UniSTS
Cytogenetic Map	4	q24	UniSTS

UniSTS:498386

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,343,486 - 81,343,571 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,297,849 - 82,297,933	NCBI	Rnor6.0
Rnor_6.0	4	82,212,325 - 82,212,409	NCBI	Rnor6.0
Rnor_5.0	4	146,879,156 - 146,879,240	UniSTS	Rnor5.0
Rnor_5.0	4	146,964,680 - 146,964,764	UniSTS	Rnor5.0
RGSC_v3.4	4	80,543,377 - 80,543,461	UniSTS	RGSC3.4
Celera	4	76,234,080 - 76,234,164	UniSTS
Cytogenetic Map	4	q24	UniSTS

UniSTS:474751

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,342,863 - 81,343,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,297,226 - 82,297,536	NCBI	Rnor6.0
Rnor_6.0	4	82,211,702 - 82,212,012	NCBI	Rnor6.0
Rnor_5.0	4	146,878,533 - 146,878,843	UniSTS	Rnor5.0
Rnor_5.0	4	146,964,057 - 146,964,367	UniSTS	Rnor5.0
RGSC_v3.4	4	80,542,754 - 80,543,064	UniSTS	RGSC3.4
Celera	4	76,233,457 - 76,233,767	UniSTS
Cytogenetic Map	4	q24	UniSTS

REN100703

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,345,248 - 81,345,474 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,299,611 - 82,299,836	NCBI	Rnor6.0
Rnor_6.0	4	82,214,087 - 82,214,312	NCBI	Rnor6.0
Rnor_5.0	4	146,880,918 - 146,881,143	UniSTS	Rnor5.0
Rnor_5.0	4	146,966,442 - 146,966,667	UniSTS	Rnor5.0
RGSC_v3.4	4	80,545,139 - 80,545,364	UniSTS	RGSC3.4
Celera	4	76,235,842 - 76,236,067	UniSTS
Cytogenetic Map	4	q24	UniSTS

REN100704

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,345,451 - 81,345,682 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,299,814 - 82,300,044	NCBI	Rnor6.0
Rnor_6.0	4	82,214,290 - 82,214,520	NCBI	Rnor6.0
Rnor_5.0	4	146,881,121 - 146,881,351	UniSTS	Rnor5.0
Rnor_5.0	4	146,966,645 - 146,966,875	UniSTS	Rnor5.0
RGSC_v3.4	4	80,545,342 - 80,545,572	UniSTS	RGSC3.4
Celera	4	76,236,045 - 76,236,275	UniSTS
Cytogenetic Map	4	q24	UniSTS

REN100706

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,345,887 - 81,346,147 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,300,250 - 82,300,509	NCBI	Rnor6.0
Rnor_6.0	4	82,214,726 - 82,214,985	NCBI	Rnor6.0
Rnor_5.0	4	146,881,557 - 146,881,816	UniSTS	Rnor5.0
Rnor_5.0	4	146,967,081 - 146,967,340	UniSTS	Rnor5.0
RGSC_v3.4	4	80,545,778 - 80,546,037	UniSTS	RGSC3.4
Celera	4	76,236,481 - 76,236,740	UniSTS
Cytogenetic Map	4	q24	UniSTS

ECD05496

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,345,709 - 81,346,446 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,300,072 - 82,300,808	NCBI	Rnor6.0
Rnor_6.0	4	82,214,548 - 82,215,284	NCBI	Rnor6.0
Rnor_5.0	4	146,881,379 - 146,882,115	UniSTS	Rnor5.0
Rnor_5.0	4	146,966,903 - 146,967,639	UniSTS	Rnor5.0
RGSC_v3.4	4	80,545,600 - 80,546,336	UniSTS	RGSC3.4
Celera	4	76,236,303 - 76,237,039	UniSTS
Cytogenetic Map	4	q24	UniSTS

Hoxa11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	81,345,990 - 81,346,064 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	82,214,829 - 82,214,902	NCBI	Rnor6.0
Rnor_6.0	4	82,300,353 - 82,300,426	NCBI	Rnor6.0
Rnor_5.0	4	146,967,184 - 146,967,257	UniSTS	Rnor5.0
Rnor_5.0	4	146,881,660 - 146,881,733	UniSTS	Rnor5.0
Celera	4	76,236,584 - 76,236,657	UniSTS
Cytogenetic Map	4	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
21	11	12	58	60	53	28	14	28	12	219	63	10	26	100	91	25

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001129878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AABR07060585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC122669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S76303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010256 ⟹ ENSRNOP00000010256

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	82,673,140 - 82,676,844 (-)	Ensembl
mRatBN7.2 Ensembl	4	81,342,528 - 81,346,232 (-)	Ensembl
Rnor_6.0 Ensembl	4	82,211,366 - 82,215,022 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000071568 ⟹ ENSRNOP00000066085

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	82,298,152 - 82,300,503 (-)	Ensembl

RefSeq Acc Id:

NM_001129878 ⟹ NP_001123350

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	82,673,139 - 82,676,801 (-)	NCBI
mRatBN7.2	4	81,342,527 - 81,346,189 (-)	NCBI

Sequence:

show sequence

GGAGAATCATGTTAAGCTCGGCTACTGCGGAGAGCCCAAGGTAGCCCAATGATGGATTTTGATG
AGCGTGGTCCCTGCTCCTCTAACATGTATTTGCCAAGTTGTACTTACTACGTCTCGGGTCCAGA
TTTCTCCAGCCTCCCTTCTTTTTTGCCCCAGACCCCGTCTTCGCGCCCAATGACATACTCCTAC
TCCTCCAACCTGCCCCAGGTCCAACCCGTGCGCGAAGTGACCTTCAGAGAATACGCCATTGAGC
CCGCCACTAAATGGCACCCCCGCGGCAATCTGGCCCACTGCTACTCCGCGGAGGAGCTCGTGCA
CAGAGACTGTCTGCAGGCGCCCAGCGCGGCCGGCGTGCCTGGCGACGTGCTGGCCAAGAGCTCG
GCCAACGTCTACCACCACCCCACCCCCGCCGTCTCGTCCAATTTCTATAGCACGGTGGGCAGGA
ACGGCGTTCTGCCACAGGCTTTCGACCAGTTTTTCGAGACGGCTTACGGCACCCCGGAAAACCT
CGCTTCCTCCGACTACCCTGGGGACAAGAACGCCGAGAAAGGGCCCCCAACAGCAGCTGCGACC
TCCGCTGCGGCGGTGGCGGCGGCGGCCACCGGCGCGCCGGCAACTTCAAGTTCGGACGGCGGTG
GCGGCGGCGGCTGTCAGGAGGCGGCGGCGGAGGAGAAGGAGCGGCGGCGGCGACCCGAGAGCAG
CAGCAGCCCCGAGTCGTCTTCCGGCCACACTGAGGACAAGGCCGGTGGCTCCGGTGGCCAACGC
ACCCGCAAAAAGCGCTGCCCTTATACCAAATACCAGATCCGAGAGCTGGAGCGAGAGTTCTTCT
TCAGCGTCTACATCAACAAAGAGAAGCGTCTGCAACTGTCCCGTATGCTCAACCTCACCGACCG
TCAAGTCAAAATCTGGTTTCAGAACAGAAGAATGAAGGAAAAAAAGATTAACAGAGACCGGTTA
CAGTACTACTCAGCTAATCCACTTCTCTAAGGCCCCCGCCTACTGGAATTGGGAGAGGGCTTCA
TACATGTGAAATAATATGCAGATTTTGCCCTTGACAAGGTCAAGCCACATTGTGACTTGGAAAA
GGGGGGGGGTGATATAGGAGAGAGGGGAGGCTTCCTTTGCAGAGATAGCCCAATAGGAAGGGGC
CTGAAACTCTCTTGGTTCAGATCTCCATGGCTAAGCTTCCTAATAATTGGATTCTAAGAGTTGT
GAATCAACAGAATGAATGGTTTGGGACCCCCTGATGGTTCACTCTTAGAGCCTGCAAAAGCTTT
GGGCTGGGTGTGGTCACTGGGGATTGGGCCCCCTGCCAAGCCCTATGGAGGCCACCCGCTCAAG
ACCCTCTGCACAGAGCCTGCCCACCCCCAGGTCTCCCCAATCAAGAAATTGTATGCCCCAAGCC
TAGTTCAGCTTGGGGATAGGGGTAGGCGGAAAGGGGAAGATTCCTAGAGATCCAGAATGGGGTT
GTTTTCCAAACGTAATGTGAAAGACAGTTGAACTAAAAGGTGGCTGTGAAATGGGAGAGAGCTG
GGGGCCCTGGAGGAATGAAAAATCTATCCAGATGACGTTAATATCTTTCCATCCCGCCTAGCTA
CCACTGATCTGCACCCAAACCTGAGCTCCTAGCAGCCACCTTTTGCAGCCCACCTGGGTCTTCT
ACCTCCCAATGGTGGTGATGGGTCTTCATTCAGGCCCCATCTCAGAACTGACAATTCCTGGGGT
AGAAGACATTGAGAAATCCAGAGGTTTTGCTGGTTGCTGGCCCCTCAATCTCTACAGGAAATGC
CTGTGGAGTTCTACAGTTTGGCAAACTCTCCACCACATTAAGGAAGCTTGGATTTGGTGTATGT
AAGGCAGCAGAGCAGTAAACCTGGCCAGTGGCTCCTTGGCCTTTGGCTATGAGGGGCTGAAGTC
TCCCCACTTCCCAACTCCCCCATCCCTACGCTGCACTCTGTGCTCATTGACTCAGAACTGAGCT
TGGGAGCTTCTGGCAATCTTCTAAGAGCCGGAGAATGATTTGGAGTTATTTTAAAAGATAAATA
TTATATTATATATATATTTCCCCGAAGGAACCAAAGCGAATTTTAAGATGCAATGTAGAGGGGG
GTGGGGATAATAAAATATTTAAAGGCTCTATCTGTTTACAGTGTTCCAAGGTTTAAACTCGCTC
ACTGCTAAAATATTTGAATGTATGCTTCATACAGGGATGGTGTTCAAAAGACTTGTAAATAAAG
AAATCATAACCTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001123350	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66717	(Get FASTA)	NCBI Sequence Viewer
	AAP31870	(Get FASTA)	NCBI Sequence Viewer
	EDL88153	(Get FASTA)	NCBI Sequence Viewer
	EDL88154	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010256
	ENSRNOP00000010256.3

Ensembl Acc Id:

ENSRNOP00000010256 ⟸ ENSRNOT00000010256

Ensembl Acc Id:

ENSRNOP00000066085 ⟸ ENSRNOT00000071568

RefSeq Acc Id:

NP_001123350 ⟸ NM_001129878

- UniProtKB:

A6K0R5 (UniProtKB/TrEMBL), B2RYB5 (UniProtKB/TrEMBL), G3V6Z0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFR
EYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFY
STVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKNAEKGPPTAAATSAAAVAAAATGAPATS
SSDGGGGGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGGSGGQRTRKKRCPYTKYQIREL
EREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL

hide sequence

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6Z0-F1-model_v2	AlphaFold	G3V6Z0	1-313	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693059

Promoter ID:

EPDNEW_R3580

Type:

initiation region

Name:

Hoxa11_1

Description:

homeobox A11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	82,300,586 - 82,300,646	EPDNEW

RGD ID:

13693061

Promoter ID:

EPDNEW_R3581

Type:

single initiation site

Name:

AABR07060585_1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	82,300,786 - 82,300,846	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564605	AgrOrtholog
BioCyc Gene	G2FUF-44811	BioCyc
Ensembl Genes	ENSRNOG00000053884	Ensembl
	ENSRNOG00000059870	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010256	ENTREZGENE
	ENSRNOT00000010256.7	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	DUF3528	UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_eu	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
KEGG Report	rno:103692131	UniProtKB/TrEMBL
NCBI Gene	Hoxa11	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN HOX-A11	UniProtKB/TrEMBL
	HOMEOBOX PROTEIN HOX-A11-RELATED	UniProtKB/TrEMBL
Pfam	DUF3528	UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
PhenoGen	Hoxa11	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000053884	RatGTEx
	ENSRNOG00000059870	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A6K0R5	ENTREZGENE, UniProtKB/TrEMBL
	B2RYB5	ENTREZGENE, UniProtKB/TrEMBL
	G3V6Z0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-27	Hoxa11	homeobox A11	LOC100909443	homeobox protein Hox-A11-like	Data merged from RGD:6503602	737654	PROVISIONAL
2013-05-24	Hoxa11	homeobox A11	RGD1566402	similar to homeobox protein	Data merged from RGD:1566402	1643240	APPROVED
2012-07-17	Hoxa11	homeobox A11	Hoxa10	homeo box A10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100909443	homeobox protein Hox-A11-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-07-05	LOC100911743	homeobox protein Hox-A11-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	RGD1566402	similar to homeobox protein	RGD1566402_predicted	similar to homeobox protein (predicted)	'predicted' is removed	2292626	APPROVED
2008-03-06	Hoxa10	homeo box A10	RGD1564605_predicted	similar to Homeobox protein A10 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564605_predicted	similar to Homeobox protein A10 (predicted)	LOC368057	similar to Homeobox protein A10	Symbol and Name status set to approved	1299863	APPROVED
2006-03-07	RGD1566402_predicted	similar to homeobox protein (predicted)	LOC500127	similar to homeobox protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC368057	similar to Homeobox protein A10			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-02-09	LOC500127	similar to homeobox protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM