Advanced Search (OLGA)

Gene: Cdk5r2 (cyclin-dependent kinase 5 regulatory subunit 2) Rattus norvegicus

Analyze

Symbol:

Cdk5r2

Name:

cyclin-dependent kinase 5 regulatory subunit 2

RGD ID:

1562530

Description:

Predicted to enable actin binding activity; cyclin-dependent protein serine/threonine kinase activator activity; and protein kinase binding activity. Predicted to be involved in axon guidance; brain development; and regulation of cytoskeleton organization. Predicted to act upstream of or within nervous system development and positive regulation of calcium ion-dependent exocytosis. Located in cytoplasm; growth cone; and membrane. Orthologous to human CDK5R2 (cyclin dependent kinase 5 regulatory subunit 2); INTERACTS WITH bisphenol A; decabromodiphenyl ether; paracetamol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cyclin-dependent kinase 5 activator 2; cyclin-dependent kinase 5, regulatory subunit 2 (p39); LOC501164; RGD1562530; similar to cyclin-dependent kinase 5 activator isoform p39 precursor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	83,864,922 - 83,866,390 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	83,864,726 - 83,867,618 (+)	Ensembl				GRCr8
mRatBN7.2	9	76,416,251 - 76,417,719 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	76,416,062 - 76,418,344 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	84,861,411 - 84,862,879 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,990,363 - 89,991,831 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	88,376,512 - 88,377,980 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	82,120,059 - 82,121,527 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	82,120,059 - 82,121,527 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	81,888,640 - 81,890,108 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	74,191,842 - 74,193,310 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	73,987,770 - 73,989,238 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cerebrotendinous xanthomatosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

cholesterol (ISO)

cisplatin (ISO)

CU-O LINKAGE (ISO)

decabromodiphenyl ether (EXP)

folic acid (ISO)

genistein (ISO)

irinotecan (ISO)

lead(0) (ISO)

Licochalcone B (ISO)

Nutlin-3 (ISO)

p-menthan-3-ol (ISO)

paracetamol (EXP,ISO)

potassium dichromate (ISO)

resveratrol (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (IBA)

brain development (IBA)

cerebellum development (ISO)

hippocampus development (ISO)

layer formation in cerebral cortex (ISO)

neuron migration (ISO)

positive regulation of calcium ion-dependent exocytosis (ISO)

positive regulation of protein kinase activity (ISO)

regulation of cytoskeleton organization (ISO)

superior olivary nucleus maturation (ISO)

Cellular Component

cytoplasm (IBA,IDA,ISO)

growth cone (IBA,IDA)

membrane (IDA)

neuron projection (IDA)

plasma membrane (IEA)

presynapse (ISO)

protein kinase 5 complex (IEA)

Molecular Function

actin binding (ISO)

cyclin-dependent protein serine/threonine kinase activator activity (IBA,IEA,ISO)

protein kinase binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	p39 activates cdk5 in neurons, and is associated with the actin cytoskeleton.	Humbert S, etal., J Cell Sci. 2000 Mar;113 ( Pt 6):975-83.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11517264	PMID:15123626	PMID:17276406

Genomics

Comparative Map Data

Cdk5r2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	83,864,922 - 83,866,390 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	83,864,726 - 83,867,618 (+)	Ensembl				GRCr8
mRatBN7.2	9	76,416,251 - 76,417,719 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	76,416,062 - 76,418,344 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	84,861,411 - 84,862,879 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,990,363 - 89,991,831 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	88,376,512 - 88,377,980 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	82,120,059 - 82,121,527 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	82,120,059 - 82,121,527 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	81,888,640 - 81,890,108 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	74,191,842 - 74,193,310 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	73,987,770 - 73,989,238 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

CDK5R2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	218,959,666 - 218,962,155 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	218,959,666 - 218,962,155 (+)	Ensembl			hg38	GRCh38
GRCh37	2	219,824,388 - 219,826,877 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	219,532,642 - 219,535,121 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	219,649,902 - 219,652,381	NCBI
Celera	2	213,594,140 - 213,596,619 (+)	NCBI		Celera
Cytogenetic Map	2	q35	NCBI
HuRef	2	211,678,607 - 211,680,905 (+)	NCBI		HuRef
CHM1_1	2	219,831,707 - 219,834,234 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	219,448,040 - 219,450,529 (+)	NCBI		T2T-CHM13v2.0

Cdk5r2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	74,894,188 - 74,896,891 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	74,894,093 - 74,896,891 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	74,855,029 - 74,857,732 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	74,854,934 - 74,857,732 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	74,901,603 - 74,904,306 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	74,788,305 - 74,789,414 (+)	NCBI		MGSCv36	mm8
Celera	1	75,410,113 - 75,412,816 (+)	NCBI		Celera
Cytogenetic Map	1	C4	NCBI
cM Map	1	38.54	NCBI

Cdk5r2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	14,472,757 - 14,473,896 (-)	Ensembl
ChiLan1.0	NW_004955453	14,471,625 - 14,474,082 (-)	NCBI	ChiLan1.0	ChiLan1.0

CDK5R2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	121,590,822 - 121,593,341 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	121,605,794 - 121,608,306 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	106,217,926 - 106,220,444 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	224,810,584 - 224,813,739 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

CDK5R2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	25,528,934 - 25,535,795 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	25,529,151 - 25,530,263 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	26,349,294 - 26,350,503 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	25,544,512 - 25,545,721 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	37	25,449,138 - 25,450,347 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	25,384,173 - 25,385,381 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	25,404,961 - 25,406,170 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cdk5r2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	175,038,311 - 175,040,812 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	1,381,262 - 1,382,365 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936569	1,381,101 - 1,383,593 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDK5R2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	120,985,257 - 120,986,354 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	120,985,069 - 120,990,864 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	133,924,680 - 133,927,298 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDK5R2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	104,858,260 - 104,860,795 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	104,858,461 - 104,859,564 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	94,532,588 - 94,535,131 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdk5r2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624823	6,053,550 - 6,054,659 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624823	6,053,469 - 6,054,748 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cdk5r2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	148,279,620 - 148,282,082 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cdk5r2
9 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	178
Count of miRNA genes:	117
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000057368
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56047863	101047863	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	40029925	85029925	Rat
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	63376862	108376862	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	65657365	108376720	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	82168823	86720295	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	44458256	99506504	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	44458256	85262605	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	41720295	86720295	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	64220169	109220169	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	64220169	109220169	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	44458256	121768150	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	64220169	109220169	Rat
1581517	Bp284	Blood pressure QTL 284			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	39220186	84220186	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	68875497	121768150	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	83161999	118999486	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	48718864	108376862	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	40029925	85029925	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	64220169	109220169	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	54506504	99506504	Rat

Markers in Region

UniSTS:484839

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	76,416,250 - 76,417,357 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	82,120,059 - 82,121,165	NCBI	Rnor6.0
Rnor_5.0	9	81,888,640 - 81,889,746	UniSTS	Rnor5.0
RGSC_v3.4	9	74,191,842 - 74,192,948	UniSTS	RGSC3.4
Celera	9	73,987,770 - 73,988,876	UniSTS
Cytogenetic Map	9	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	3	14	143	38	27	13	11	13	3	88	41	128	18	69	14	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC132020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057368 ⟹ ENSRNOP00000054180

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	83,864,726 - 83,867,618 (+)	Ensembl
mRatBN7.2 Ensembl	9	76,416,062 - 76,418,344 (+)	Ensembl
Rnor_6.0 Ensembl	9	82,120,059 - 82,121,527 (+)	Ensembl

RefSeq Acc Id:

NM_001109309 ⟹ NP_001102779

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	83,864,922 - 83,866,390 (+)	NCBI
mRatBN7.2	9	76,416,251 - 76,417,719 (+)	NCBI
Rnor_6.0	9	82,120,059 - 82,121,527 (+)	NCBI
Rnor_5.0	9	81,888,640 - 81,890,108 (+)	NCBI
RGSC_v3.4	9	74,191,842 - 74,193,310 (+)	RGD
Celera	9	73,987,770 - 73,989,238 (+)	RGD

Sequence:

show sequence

ATGGGCACGGTGCTGTCGCTTTCCCCTGCTTCCTCGGCCAAGGGCCGGAGGCCGGGAGGGCTGC
CGGAGGAGAAAAAGAAGGCGCCGCCCGCGGGGGACGAGGCGCTGGGGGGCTACGGCGCGCCGCC
GGCCGGCAAGGGCGGCAAAGGCGAGAGCCGGCTCAAACGGCCGTCCGTACTCATCTCGGCGCTC
ACCTGGAAGCGCCTAGTGGCAGCCTCGGCCAAGAAGAAGAAAGGCAGCAAAAAGGTGACGCCCA
AGCCAGCGTCCACCGGTCCCGACCCTTTGGTCCAGCAACGCAACCGGGAGAACCTTCTCCGCAA
GGGTCGCGACGCCCCCGACGGCGGCGGAGCAGCCAAGCCCCTGGCCGTGCCGGTGCCCACGGTG
CCCGCGTCCGCTGCCACCTGCGAGCCCCCGTCGGGGGGCAGCGCGGCCGCCCCGCCACCAGGCT
CAGGCGGGGGAAAGCCACCTCCGCCGCCACCTCCAGCCCCGCAGGCGGCACCGCCAGCGCCCGG
AGGCTCGCCGCGACGGGTCATCGTGCAGGCGTCCACCGGCGAGCTGCTCCGCTGCCTCGGCGAC
TTCGTGTGCCGACGCTGCTACCGCCTCAAGGAGCTGAGTCCCGGCGAGCTGGTGGGCTGGTTCC
GCGGCGTGGACCGCTCGCTGCTGCTGCAGGGCTGGCAAGACCAGGCCTTCATTACCCCCGCCAA
CCTGGTGTTCGTGTACCTGCTGTGCCGCGAGTCGCTGCGCGGGGACGAGCTGGCGTCGGCCGCC
GAACTGCAGGCCGCCTTCCTCACCTGCCTCTACCTCGCCTACTCCTACATGGGCAACGAGATCT
CCTACCCACTCAAGCCCTTCCTCGTGGAGCCCGACAAGGAGCGCTTCTGGCAGCGCTGCCTGCG
CCTCATCCAGCGGCTCAGCCCGCAGATGCTGCGGCTCAACGCCGACCCCCACTTCTTCACGCAA
GTCTTTCAAGACCTCAAGAACGAGGGCGAGGCCGCGGCGAGCACCGGGGGTCCACCGAGCGGAA
GCGCGTCCACCACCTCCTCGTCGACCGCCAGGGACAGCTGCGCGGCCGGAGCCAAGCATTGGAC
TATGAACTTGGACCGCTAGGGATTCCCAGGGGCCGCGCCCGCCCCCCGCCCCAGCCCCTCACAC
ACACCCGGAACCCCCGGGACCATCAAGCCACCGTCGCTATTACCGCTGCTCTATGCCCAGGCTG
GGCCGAGGAGGAGCCGCCCCTGCCCCACAGGGGAAGGTGGAGGCTAGGACACCAGAGGCCGCGG
TGTCTGGATAAACTGGGCGTGGGGTGGGCGTGGGGGATGATCGCGGGAAGTGCACCCCCAACTT
CGTTCACCCTTTCCGTCTGTCTGCGCCTCCATCTTTCCATTTCTGCCCTGGTCTCCCTCTTCCC
TGCTGTGGGCATCTCAAAGTCCTCCACCCTGGGTTTTGTCCAGTCCCTCACTTTTCTGTGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102779	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75372	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054180.3

RefSeq Acc Id:

NP_001102779 ⟸ NM_001109309

- UniProtKB:

F1M491 (UniProtKB/TrEMBL), A6JVW4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVLISAL
TWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDAPDGGGAAKPLAVPVPTV
PASAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGSPRRVIVQASTGELLRCLGD
FVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAA
ELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQ
VFQDLKNEGEAAASTGGPPSGSASTTSSSTARDSCAAGAKHWTMNLDR

hide sequence

Ensembl Acc Id:

ENSRNOP00000054180 ⟸ ENSRNOT00000057368

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M491-F1-model_v2	AlphaFold	F1M491	1-368	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696762

Promoter ID:

EPDNEW_R7286

Type:

multiple initiation site

Name:

Cdk5r2_1

Description:

cyclin-dependent kinase 5 regulatory subunit 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	82,119,994 - 82,120,054	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562530	AgrOrtholog
BioCyc Gene	G2FUF-27113	BioCyc
Ensembl Genes	ENSRNOG00000037793	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000057368.4	UniProtKB/TrEMBL
Gene3D-CATH	Cyclin-like	UniProtKB/TrEMBL
InterPro	CDK5_activator	UniProtKB/TrEMBL
	Cyclin-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:501164	UniProtKB/TrEMBL
NCBI Gene	501164	ENTREZGENE
PANTHER	CYCLIN-DEPENDENT KINASE 5 ACTIVATOR 2	UniProtKB/TrEMBL
	PTHR23401	UniProtKB/TrEMBL
Pfam	CDK5_activator	UniProtKB/TrEMBL
PhenoGen	Cdk5r2	PhenoGen
PIRSF	Cdk5_activator	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000037793	RatGTEx
Superfamily-SCOP	Cyclin_like	UniProtKB/TrEMBL
UniProt	A6JVW4	ENTREZGENE, UniProtKB/TrEMBL
	F1M491	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-01	Cdk5r2	cyclin-dependent kinase 5 regulatory subunit 2	Cdk5r2	cyclin-dependent kinase 5, regulatory subunit 2 (p39)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Cdk5r2	cyclin-dependent kinase 5, regulatory subunit 2 (p39)	RGD1562530_predicted	similar to cyclin-dependent kinase 5 activator isoform p39 precursor (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562530_predicted	similar to cyclin-dependent kinase 5 activator isoform p39 precursor (predicted)	LOC501164	similar to cyclin-dependent kinase 5 activator isoform p39 precursor	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC501164	similar to cyclin-dependent kinase 5 activator isoform p39 precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar