Advanced Search (OLGA)

Gene: Enpp7 (ectonucleotide pyrophosphatase/phosphodiesterase 7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Enpp7

Name:

ectonucleotide pyrophosphatase/phosphodiesterase 7

RGD ID:

1359324

Description:

Enables sphingomyelin phosphodiesterase activity. Predicted to be involved in several processes, including fatty acid homeostasis; positive regulation of intestinal cholesterol absorption; and regulation of membrane lipid metabolic process. Predicted to be located in Golgi apparatus; microvillus; and plasma membrane. Orthologous to human ENPP7 (ectonucleotide pyrophosphatase/phosphodiesterase 7); PARTICIPATES IN Fabry disease pathway; Gaucher's disease pathway; Krabbe disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; bisphenol A.

Type:

protein-coding (Ensembl: pseudogene)

RefSeq Status:

VALIDATED

Previously known as:

alk-SMase; alkaline sphingomyelin phosphodiesterase; E-NPP 7; E-NPP7; ectonucleotide pyrophosphatase/phosphodiesterase family member 7; intestinal alkaline sphingomyelinase; LOC303729; NPP-7; sphingomyelinase, intestinal alkaline

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	104,740,763 - 104,745,760 (+)	NCBI		GRCr8
mRatBN7.2	10	104,242,169 - 104,247,185 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	104,242,223 - 104,246,589 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	109,345,533 - 109,350,503 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	108,808,555 - 108,813,525 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	104,162,858 - 104,167,855 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	108,095,131 - 108,099,483 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	108,095,131 - 108,099,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	107,709,166 - 107,713,518 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	102,790,410 - 102,794,661 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	Idiopathic Generalized Epilepsy		ISO	ENPP7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532
Enpp7	Rat	pityriasis rubra pilaris		ISO	ENPP7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pityriasis rubra pilaris	ClinVar	PMID:28492532
Enpp7	Rat	prostate cancer		ISO	ENPP7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	1H-imidazole	decreases activity	ISO	ENPP7 (Homo sapiens)	6480464	imidazole results in decreased activity of ENPP7 protein	CTD	PMID:12885774
Enpp7	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of ENPP7 mRNA	CTD	PMID:22298810
Enpp7	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of ENPP7 mRNA	CTD	PMID:28959563
Enpp7	Rat	aflatoxin B1	decreases expression	ISO	ENPP7 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of ENPP7 mRNA	CTD	PMID:27153756
Enpp7	Rat	aflatoxin B1	decreases methylation	ISO	ENPP7 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of ENPP7 gene	CTD	PMID:27153756
Enpp7	Rat	amiodarone	increases expression	ISO	ENPP7 (Homo sapiens)	6480464	Amiodarone results in increased expression of ENPP7 mRNA	CTD	PMID:19774075
Enpp7	Rat	ATP	decreases activity	ISO	ENPP7 (Homo sapiens)	6480464	Adenosine Triphosphate results in decreased activity of ENPP7 protein	CTD	PMID:12885774
Enpp7	Rat	benzo[a]pyrene	decreases methylation	ISO	ENPP7 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of ENPP7 promoter	CTD	PMID:27901495
Enpp7	Rat	benzo[a]pyrene	decreases expression	ISO	ENPP7 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of ENPP7 mRNA	CTD	PMID:32234424
Enpp7	Rat	benzo[a]pyrene	increases methylation	ISO	ENPP7 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of ENPP7 3' UTR	CTD	PMID:27901495
Enpp7	Rat	benzo[e]pyrene	decreases methylation	ISO	ENPP7 (Homo sapiens)	6480464	benzo(e)pyrene results in decreased methylation of ENPP7 intron	CTD	PMID:30157460
Enpp7	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of ENPP7 mRNA	CTD	PMID:25181051
Enpp7	Rat	bisphenol A	decreases methylation	ISO	Enpp7 (Mus musculus)	6480464	bisphenol A results in decreased methylation of ENPP7 promoter	CTD	PMID:27312807
Enpp7	Rat	bromobenzene	decreases expression	EXP		6480464	bromobenzene results in decreased expression of ENPP7 mRNA	CTD	PMID:32479839
Enpp7	Rat	chlorpyrifos	decreases expression	ISO	Enpp7 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of ENPP7 mRNA	CTD	PMID:37019170
Enpp7	Rat	chromium(6+)	affects expression	ISO	Enpp7 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of ENPP7 mRNA	CTD	PMID:28472532
Enpp7	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of ENPP7 mRNA	CTD	PMID:26033743
Enpp7	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of ENPP7 mRNA	CTD	PMID:26033743
Enpp7	Rat	cyclosporin A	increases expression	ISO	ENPP7 (Homo sapiens)	6480464	Cyclosporine results in increased expression of ENPP7 mRNA	CTD	PMID:27989131
Enpp7	Rat	dicrotophos	increases expression	ISO	ENPP7 (Homo sapiens)	6480464	dicrotophos results in increased expression of ENPP7 mRNA	CTD	PMID:28302478
Enpp7	Rat	ethylenediaminetetraacetic acid	multiple interactions	ISO	ENPP7 (Homo sapiens)	6480464	Edetic Acid inhibits the reaction [Zinc results in decreased activity of ENPP7 protein]	CTD	PMID:12885774
Enpp7	Rat	fluorescein 5-isothiocyanate	affects binding	ISO	ENPP7 (Homo sapiens)	6480464	Fluorescein-5-isothiocyanate binds to ENPP7 protein	CTD	PMID:27129696
Enpp7	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ENPP7 mRNA	CTD	PMID:22129741
Enpp7	Rat	lysophosphatidylcholine	increases hydrolysis	ISO	ENPP7 (Homo sapiens)	6480464	ENPP7 protein results in increased hydrolysis of Lysophosphatidylcholines	CTD	PMID:12885774
Enpp7	Rat	methapyrilene	decreases methylation	ISO	ENPP7 (Homo sapiens)	6480464	Methapyrilene results in decreased methylation of ENPP7 intron	CTD	PMID:30157460
Enpp7	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ENPP7 mRNA	CTD	PMID:22129741
Enpp7	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ENPP7 mRNA	CTD	PMID:22129741
Enpp7	Rat	paracetamol	decreases expression	ISO	ENPP7 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of ENPP7 mRNA	CTD	PMID:26690555
Enpp7	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Enpp7 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of ENPP7 mRNA	CTD	PMID:37995155
Enpp7	Rat	phosphatidylcholine	increases hydrolysis	ISO	ENPP7 (Homo sapiens)	6480464	ENPP7 protein results in increased hydrolysis of Phosphatidylcholines	CTD	PMID:12885774
Enpp7	Rat	sodium arsenite	decreases expression	ISO	ENPP7 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of ENPP7 mRNA	CTD	PMID:29301061
Enpp7	Rat	sodium arsenite	increases expression	ISO	Enpp7 (Mus musculus)	6480464	sodium arsenite results in increased expression of ENPP7 mRNA	CTD	PMID:37682722
Enpp7	Rat	titanium dioxide	decreases methylation	ISO	Enpp7 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of ENPP7 enhancer	CTD	PMID:35295148
Enpp7	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of ENPP7 mRNA	CTD	PMID:33387578
Enpp7	Rat	tris(2-butoxyethyl) phosphate	affects expression	ISO	ENPP7 (Homo sapiens)	6480464	tris(2-butoxyethyl) phosphate affects the expression of ENPP7 mRNA	CTD	PMID:29024780
Enpp7	Rat	valproic acid	affects expression	ISO	Enpp7 (Mus musculus)	6480464	Valproic Acid affects the expression of ENPP7 mRNA	CTD	PMID:17963808
Enpp7	Rat	valproic acid	increases methylation	ISO	ENPP7 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of ENPP7 gene	CTD	PMID:29154799
Enpp7	Rat	zinc atom	decreases activity	ISO	ENPP7 (Homo sapiens)	6480464	Zinc results in decreased activity of ENPP7 protein	CTD	PMID:12885774
Enpp7	Rat	zinc atom	multiple interactions	ISO	ENPP7 (Homo sapiens)	6480464	Edetic Acid inhibits the reaction [Zinc results in decreased activity of ENPP7 protein]	CTD	PMID:12885774
Enpp7	Rat	zinc(0)	decreases activity	ISO	ENPP7 (Homo sapiens)	6480464	Zinc results in decreased activity of ENPP7 protein	CTD	PMID:12885774
Enpp7	Rat	zinc(0)	multiple interactions	ISO	ENPP7 (Homo sapiens)	6480464	Edetic Acid inhibits the reaction [Zinc results in decreased activity of ENPP7 protein]	CTD	PMID:12885774

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	fatty acid homeostasis	involved_in	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	fatty acid homeostasis	involved_in	ISO	Enpp7 (Mus musculus)	1624291	PMID:21177474	RGD	PMID:21177474
Enpp7	Rat	lipid digestion	involved_in	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	lipid digestion	involved_in	ISO	Enpp7 (Mus musculus)	1624291	PMID:21177474	RGD	PMID:21177474
Enpp7	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Enpp7	Rat	negative regulation of cell population proliferation	involved_in	ISO	ENPP7 (Homo sapiens)	1624291	PMID:12671034	RGD	PMID:12671034
Enpp7	Rat	negative regulation of DNA replication	involved_in	ISO	ENPP7 (Homo sapiens)	1624291	PMID:12671034	RGD	PMID:12671034
Enpp7	Rat	positive regulation of ceramide biosynthetic process	involved_in	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	positive regulation of ceramide biosynthetic process	involved_in	ISO	Enpp7 (Mus musculus)	1624291	PMID:21177474	RGD	PMID:21177474
Enpp7	Rat	positive regulation of intestinal cholesterol absorption	involved_in	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	positive regulation of intestinal cholesterol absorption	involved_in	ISO	Enpp7 (Mus musculus)	1624291	PMID:24650549	RGD	PMID:24650549
Enpp7	Rat	positive regulation of sphingomyelin catabolic process	involved_in	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	positive regulation of sphingomyelin catabolic process	involved_in	ISO	Enpp7 (Mus musculus)	1624291	PMID:21177474	RGD	PMID:21177474
Enpp7	Rat	regulation of intestinal lipid absorption	involved_in	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	regulation of intestinal lipid absorption	involved_in	ISO	Enpp7 (Mus musculus)	1624291	PMID:21177474	RGD	PMID:21177474
Enpp7	Rat	sphingomyelin metabolic process	involved_in	ISS	UniProtKB:Q6UWV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	sphingomyelin metabolic process	involved_in	ISO	ENPP7 (Homo sapiens)	1624291	PMID:12671034 more ...	RGD	PMID:12671034 more ...

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	Golgi apparatus	located_in	ISO	ENPP7 (Homo sapiens)	1624291	PMID:12671034	RGD	PMID:12671034
Enpp7	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Enpp7	Rat	microvillus	located_in	ISO	ENPP7 (Homo sapiens)	1624291	PMID:12671034	RGD	PMID:12671034
Enpp7	Rat	plasma membrane	located_in	ISS	UniProtKB:Q6UWV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Enpp7	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Enpp7	Rat	plasma membrane	located_in	ISO	ENPP7 (Homo sapiens)	1624291	PMID:15205117	RGD	PMID:15205117

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Enpp7	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Enpp7	Rat	phosphoric diester hydrolase activity	enables	IDA		25671389	PMID:16255717	UniProt
Enpp7	Rat	phosphoric diester hydrolase activity	enables	ISO	ENPP7 (Homo sapiens)	1624291	PMID:16255717	RGD	PMID:16255717
Enpp7	Rat	protein binding	enables	ISO	ENPP7 (Homo sapiens)	1624291	UniProtKB:P26371 more ...	RGD	PMID:32296183
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	ISS	UniProtKB:Q6UWV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	IEA	EC:3.1.4.12	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	IEA	RHEA:19253	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	ISO	ENPP7 (Homo sapiens)	1624291	PMID:12671034 more ...	RGD	PMID:12671034 more ...
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	ISO	Enpp7 (Mus musculus)	1624291	PMID:21177474	RGD	PMID:21177474
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	IDA		25671389	PMID:16255717	UniProt
Enpp7	Rat	sphingomyelin phosphodiesterase activity	enables	ISS	UniProtKB:Q3TIW9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	zinc ion binding	enables	ISS	UniProtKB:Q6UWV6	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Enpp7	Rat	zinc ion binding	enables	ISO	ENPP7 (Homo sapiens)	1624291	PMID:28292932	RGD	PMID:28292932

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	Fabry disease pathway		ISO	ENPP7 (Homo sapiens)	10402751		SMPDB	SMP:00525
Enpp7	Rat	Gaucher's disease pathway		ISO	ENPP7 (Homo sapiens)	10402751		SMPDB	SMP:00349
Enpp7	Rat	Krabbe disease pathway		ISO	ENPP7 (Homo sapiens)	10402751		SMPDB	SMP:00348
Enpp7	Rat	metachromatic leukodystrophy pathway		ISO	ENPP7 (Homo sapiens)	10402751		SMPDB	SMP:00347
Enpp7	Rat	sphingolipid metabolic pathway		ISO	ENPP7 (Homo sapiens)	10402751		SMPDB	SMP:00034

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Enpp7	Rat	sphingolipid metabolic pathway		IEA		6907045		KEGG	rno:00600

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Intestinal alkaline sphingomyelinase hydrolyses and inactivates platelet-activating factor by a phospholipase C activity.	Wu J, etal., Biochem J. 2006 Feb 15;394(Pt 1):299-308. doi: 10.1042/BJ20051121.
8.	Cloning of alkaline sphingomyelinase from rat intestinal mucosa and adjusting of the hypothetical protein XP_221184 in GenBank.	Wu J, etal., Biochim Biophys Acta 2005 Feb 21;1687(1-3):94-102.

PMID:12671034	PMID:12885774	PMID:15205117	PMID:17204455	PMID:28292932

Enpp7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	104,740,763 - 104,745,760 (+)	NCBI		GRCr8
mRatBN7.2	10	104,242,169 - 104,247,185 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	104,242,223 - 104,246,589 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	109,345,533 - 109,350,503 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	108,808,555 - 108,813,525 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	104,162,858 - 104,167,855 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	108,095,131 - 108,099,483 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	108,095,131 - 108,099,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	107,709,166 - 107,713,518 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	102,790,410 - 102,794,661 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

ENPP7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	79,730,943 - 79,742,219 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	79,730,943 - 79,742,219 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	77,704,705 - 77,716,018 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	75,319,477 - 75,330,616 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	75,319,476 - 75,330,615	NCBI
Celera	17	74,329,818 - 74,341,104 (+)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	73,145,753 - 73,156,851 (+)	NCBI		HuRef
CHM1_1	17	77,791,152 - 77,802,246 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	80,628,701 - 80,640,020 (+)	NCBI		T2T-CHM13v2.0

Enpp7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	118,879,007 - 118,884,047 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	118,879,014 - 118,884,047 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	118,988,181 - 118,993,221 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	118,988,188 - 118,993,221 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	118,849,502 - 118,854,155 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	118,804,278 - 118,808,931 (+)	NCBI		MGSCv36	mm8
Celera	11	130,732,697 - 130,737,351 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	83.33	NCBI

Enpp7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	3,151,133 - 3,154,613 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	3,151,133 - 3,154,613 (-)	NCBI	ChiLan1.0	ChiLan1.0

ENPP7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	95,785,533 - 95,796,981 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	100,614,540 - 100,625,983 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	73,811,249 - 73,822,719 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	79,347,505 - 79,359,349 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	79,347,505 - 79,359,349 (+)	Ensembl	panpan1.1		panPan2

ENPP7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	1,887,093 - 1,894,728 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	1,887,201 - 1,897,473 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	2,530,265 - 2,537,749 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	2,522,957 - 2,530,442 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	2,522,959 - 2,532,965 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	2,546,349 - 2,553,429 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	2,671,411 - 2,678,888 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	2,752,722 - 2,760,208 (-)	NCBI		UU_Cfam_GSD_1.0

Enpp7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	2,553,048 - 2,557,497 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	3,855,150 - 3,858,317 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	3,855,071 - 3,864,034 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ENPP7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	2,612,574 - 2,619,519 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	2,612,543 - 2,619,541 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	2,680,088 - 2,687,063 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ENPP7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	71,693,148 - 71,701,517 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	71,693,851 - 71,699,926 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	42,988,775 - 43,000,398 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Enpp7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	8,895,836 - 8,903,952 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	8,895,138 - 8,901,848 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Enpp7
130 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	54
Count of miRNA genes:	50
Interacting mature miRNAs:	53
Transcripts:	ENSRNOT00000073470
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	14	26	26	21	5	21	3	36	5	11	9	31	5


RefSeq Transcripts	NM_001012466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY568760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073470 ⟹ ENSRNOP00000064040

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	104,242,223 - 104,246,589 (+)	Ensembl
Rnor_6.0 Ensembl	10	108,095,131 - 108,099,483 (+)	Ensembl

RefSeq Acc Id:

NM_001012466 ⟹ NP_001012484

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,740,763 - 104,745,760 (+)	NCBI
mRatBN7.2	10	104,242,169 - 104,247,185 (+)	NCBI
Rnor_6.0	10	108,095,131 - 108,099,483 (+)	NCBI
Rnor_5.0	10	107,709,166 - 107,713,518 (+)	NCBI
Celera	10	102,790,410 - 102,794,661 (+)	RGD

Sequence:

show sequence

ATGGGGCACTCAGCTGTCCTCCTCTCTGTGGCTCTAGTCATCCTCCCAGCTTGTGTGACTGGGGGTCCTGTCCAAAGGCAGCAGCAGCATAAGCTTCTCCTTGTATCCTTCGATGGCTTCCGCTGGAA
CTATGACCAAGACGTGGAAACCCCTAACCTGGACTCCATGGCTCAGGAAGGAGTGAAAGCTCGCTACATGACTCCTGCCTTTGTCACCATGACCAGCCCCTGCCACTTTACACTGGTCACCGGCAAAT
ACATCGAGAACCATGGGGTGGTCCACAACATGTTCTATAACACCACCAACAAGGTGAGGCTGCCCTACCATGCCACGCTTGGGATCCAGAGGTGGTGGGATAACGGCAGCATACCCATCTGGATCACA
GCCCAGAGGCAGGGCTTAAAAACCGGCTCCTTCTTCTACCCTGGTGGGAACGTCACCTACCAAGGAGAGGCCGTGACGATGAGCCGGAAGGAAGGCGTCTTACACAATTACAAAAACGAGACAGAGTG
GAGGGCAAATGTGGACACAGTGATGAAGTGGTTCACGGAGGAGGATGTGTCCCTGGTCACTCTCTACTTTGGGGAGCCAGACTCCACTGGCCACAAGTATGGCCCTGAGTCCCAGGAGAGGAAGGACA
TGGTGAAACAGGTAGACAGGACGGTGGGCTACCTCCGGGACAGCATCAAGCGCCACCACCTCACAGACAGCCTCAACCTGATAATCACCTCGGACCACGGCATGACGACCGTCAACAAGAAGGCCAGC
GACTTGGTCGAGTTCCACAAGTTCCCCAACTTCACCTTCAGGGACATTGAGTTCGAACTCTTGGACTACGGGCCCAACGGGATGCTGATCCCCAAGGAAGGGATGCTGGAGAAGGTATACAGTGTCCT
CAAGGATGCCCACCCCAGGCTGCATGTGTACAAGAAGGAGGACTTCCCGAAGACCTTTCACTACGCCAACAACCCCAGGATCACATCCCTGCTCATGTACAGTGACCTCGGCTATGTCATTCATGGGA
GAGTGAACGTCCAGTTCAACAGTGGTGAGCATGGTTTCGACAACCAAGACATGGACATGAAGACCATCTTCCGGGCTGTGGGTCCCAGCTTCAAGGCAGGCTTGGAAGTGGAGCCCTTCGAGAGCGTC
CATGTGTACGAGCTCATGTGTCAGCTGCTGGGCATTGTGCCCGAGCCCAACGATGGGCATCCAGGCGTCCTGCAACCCATGCTCCGGTCAGGATCTCCGCTCAGCAGGCAGCACCACTTGGTGGTGGT
GTTGATGGGGATCCTAACGGGTCTGGCCAAGGTCGTATAA

hide sequence


Protein RefSeqs	NP_001012484	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAU03450	(Get FASTA)	NCBI Sequence Viewer
	EDM06769	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000107466
GenBank Protein	Q5EZ72	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001012484 ⟸ NM_001012466
- Peptide Label:	precursor
- UniProtKB:	Q5EZ72 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGHSAVLLSVALVILPACVTGGPVQRQQQHKLLLVSFDGFRWNYDQDVETPNLDSMAQEGVKARYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMFYNTTNKVRLPYHATLGIQRWWDNGSIPIWIT AQRQGLKTGSFFYPGGNVTYQGEAVTMSRKEGVLHNYKNETEWRANVDTVMKWFTEEDVSLVTLYFGEPDSTGHKYGPESQERKDMVKQVDRTVGYLRDSIKRHHLTDSLNLIITSDHGMTTVNKKAS DLVEFHKFPNFTFRDIEFELLDYGPNGMLIPKEGMLEKVYSVLKDAHPRLHVYKKEDFPKTFHYANNPRITSLLMYSDLGYVIHGRVNVQFNSGEHGFDNQDMDMKTIFRAVGPSFKAGLEVEPFESV HVYELMCQLLGIVPEPNDGHPGVLQPMLRSGSPLSRQHHLVVVLMGILTGLAKVV hide sequence

Ensembl Acc Id:

ENSRNOP00000064040 ⟸ ENSRNOT00000073470

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5EZ72-F1-model_v2	AlphaFold	Q5EZ72	1-439	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697939

Promoter ID:

EPDNEW_R8464

Type:

initiation region

Name:

Enpp7_1

Description:

ectonucleotide pyrophosphatase/phosphodiesterase 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	108,095,078 - 108,095,138	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-22509	BioCyc
Ensembl Genes	ENSRNOG00000047026	Ensembl
	ENSRNOG00000081693	ENTREZGENE
Ensembl Transcript	ENSRNOT00000151666	ENTREZGENE
Gene3D-CATH	3.30.1360.180	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.720.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Alkaline_phosphatase_core_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Phosphodiest/P_Trfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:303729	UniProtKB/Swiss-Prot
NCBI Gene	303729	ENTREZGENE
PANTHER	ECTONUCLEOTIDE PYROPHOSPHATASE/PHOSPHODIESTERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ECTONUCLEOTIDE PYROPHOSPHATASE/PHOSPHODIESTERASE FAMILY MEMBER 7	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	Phosphodiest	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Enpp7	PhenoGen
RatGTEx	ENSRNOG00000047026	RatGTEx
Superfamily-SCOP	Alkaline phosphatase-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6HL64_RAT	UniProtKB/TrEMBL
	ENPP7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Enpp7	ectonucleotide pyrophosphatase/phosphodiesterase 7	LOC303729	sphingomyelinase, intestinal alkaline	Symbol and Name updated	1299863	APPROVED
2005-07-29	LOC303729	sphingomyelinase, intestinal alkaline			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)