Advanced Search (OLGA)

Gene: Nek7 (NIMA-related kinase 7) Rattus norvegicus

Analyze

Symbol:

Nek7

Name:

NIMA-related kinase 7

RGD ID:

1311160

Description:

Enables protein serine/threonine kinase activity. Predicted to be involved in several processes, including cellular response to potassium ion; positive regulation of NLRP3 inflammasome complex assembly; and protein phosphorylation. Predicted to act upstream of or within several processes, including cytokine-mediated signaling pathway; positive regulation of defense response; and positive regulation of macromolecule metabolic process. Predicted to be located in cytoplasm. Predicted to be active in microtubule organizing center and nucleus. Orthologous to human NEK7 (NIMA related kinase 7); INTERACTS WITH 2,6-dinitrotoluene; 6-propyl-2-thiouracil; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC360850; never in mitosis A-related kinase 7; NIMA (never in mitosis gene a)-related expressed kinase 7; NIMA (never in mitosis gene a)-related kinase 7; nimA-related protein kinase 7; serine/threonine-protein kinase Nek7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NEK7 (NIMA related kinase 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nek7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NEK7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NEK7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nek7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NEK7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NEK7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nek7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nek7 (NIMA related kinase 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HSCB (HscB mitochondrial iron-sulfur cluster cochaperone)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NEK7 (NIMA related kinase 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nek7 (NIMA-related kinase 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nekl-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nek7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nek7	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	52,573,730 - 52,700,869 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	52,573,730 - 52,700,823 (-)	Ensembl				GRCr8
mRatBN7.2	13	50,022,212 - 50,149,374 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	50,022,218 - 50,149,296 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	52,633,583 - 52,702,078 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	53,921,489 - 53,989,987 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	51,188,092 - 51,257,283 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	55,485,759 - 55,617,534 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	55,488,531 - 55,561,750 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	60,515,259 - 60,641,914 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	51,679,191 - 51,942,636 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	50,308,775 - 50,377,141 (-)	NCBI		Celera
RGSC_v3.1	13	51,696,338 - 51,802,947 (-)	NCBI
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-tribromophenol (ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (EXP,ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

ATP (ISO)

Bavachinin (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

lipopolysaccharide (ISO)

methapyrilene (EXP)

methoxychlor (EXP)

nickel atom (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

raloxifene (ISO)

rimonabant (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulindac (EXP)

tamoxifen (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to potassium ion (IEA,ISO,ISS)

positive regulation of NLRP3 inflammasome complex assembly (IBA,IEA,ISO,ISS)

positive regulation of telomere maintenance (ISO)

protein phosphorylation (ISO,ISS)

regulation of kinase activity (ISO)

regulation of mitotic cell cycle (IEA,ISO,ISS)

Cellular Component

centrosome (IEA)

cytoplasm (IEA,ISO,ISS)

microtubule organizing center (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

spindle pole (IEA)

Molecular Function

ATP binding (IEA)

kinase activity (IEA)

metal ion binding (IEA)

molecular function activator activity (IEA,ISO,ISS)

nucleotide binding (IEA)

protein binding (ISO)

protein kinase activity (IEA)

protein serine kinase activity (IEA)

protein serine/threonine kinase activity (IBA,IDA,IEA,ISO)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of the NIMA family kinases NEK6/7 as regulators of the p70 ribosomal S6 kinase.	Belham C, etal., Curr Biol. 2001 Aug 7;11(15):1155-67.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12840024	PMID:21531765	PMID:26188091	PMID:31505169	PMID:34414459

Genomics

Comparative Map Data

Nek7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	52,573,730 - 52,700,869 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	52,573,730 - 52,700,823 (-)	Ensembl				GRCr8
mRatBN7.2	13	50,022,212 - 50,149,374 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	50,022,218 - 50,149,296 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	52,633,583 - 52,702,078 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	53,921,489 - 53,989,987 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	51,188,092 - 51,257,283 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	55,485,759 - 55,617,534 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	55,488,531 - 55,561,750 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	60,515,259 - 60,641,914 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	51,679,191 - 51,942,636 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	50,308,775 - 50,377,141 (-)	NCBI		Celera
RGSC_v3.1	13	51,696,338 - 51,802,947 (-)	NCBI
Cytogenetic Map	13	q13	NCBI

NEK7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	198,156,998 - 198,322,420 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	198,156,883 - 198,322,451 (+)	Ensembl			hg38	GRCh38
GRCh37	1	198,126,128 - 198,291,550 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	196,468,306 - 196,555,392 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	194,933,338 - 195,020,426	NCBI
Celera	1	171,248,701 - 171,414,114 (+)	NCBI		Celera
Cytogenetic Map	1	q31.3	NCBI
HuRef	1	169,281,535 - 169,446,709 (+)	NCBI		HuRef
CHM1_1	1	199,548,440 - 199,713,855 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	197,416,379 - 197,581,805 (+)	NCBI		T2T-CHM13v2.0

Nek7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	138,411,575 - 138,547,481 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	138,410,613 - 138,547,879 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	138,483,837 - 138,619,757 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	138,482,875 - 138,620,141 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	140,381,291 - 140,516,273 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	140,301,125 - 140,436,107 (-)	NCBI		MGSCv36	mm8
Celera	1	141,116,690 - 141,252,989 (-)	NCBI		Celera
Cytogenetic Map	1	E4	NCBI
cM Map	1	60.82	NCBI

Nek7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	34,626,494 - 34,717,546 (+)	Ensembl
ChiLan1.0	NW_004955406	34,575,292 - 34,714,024 (+)	NCBI	ChiLan1.0	ChiLan1.0

NEK7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	51,064,827 - 51,230,182 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	51,024,328 - 51,189,816 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	173,752,892 - 173,918,258 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	178,063,721 - 178,228,197 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	178,138,925 - 178,228,197 (+)	Ensembl			panPan2	panpan1.1

NEK7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	4,557,754 - 4,755,912 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	4,555,231 - 4,704,955 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	4,242,787 - 4,401,020 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	4,244,695 - 4,403,399 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	4,244,697 - 4,401,233 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	4,191,041 - 4,349,354 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	4,291,900 - 4,450,309 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	4,323,524 - 4,481,976 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nek7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	76,450,900 - 76,580,386 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936567	5,685,125 - 5,808,499 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936567	5,685,619 - 5,815,094 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NEK7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	20,966,651 - 21,124,271 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	20,966,660 - 21,124,283 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	25,627,135 - 25,785,075 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NEK7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	31,111,332 - 31,257,445 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	31,110,616 - 31,257,374 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	32,000,563 - 32,147,161 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nek7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624798	2,116,900 - 2,198,999 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624798	2,116,888 - 2,283,061 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nek7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	18,834,599 - 18,967,590 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nek7
1372 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	99
Interacting mature miRNAs:	106
Transcripts:	ENSRNOT00000000817
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Markers in Region

BF386197

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	50,038,614 - 50,038,770 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	55,502,217 - 55,502,372	NCBI	Rnor6.0
Rnor_5.0	13	60,531,717 - 60,531,872	UniSTS	Rnor5.0
RGSC_v3.4	13	51,696,144 - 51,696,299	UniSTS	RGSC3.4
Celera	13	50,322,354 - 50,322,509	UniSTS
Cytogenetic Map	13	q13	UniSTS

RH136376

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	52,575,592 - 52,575,858 (+)	Marker Load Pipeline
mRatBN7.2	13	50,024,073 - 50,024,340 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	55,487,621 - 55,487,887	NCBI	Rnor6.0
Rnor_5.0	13	60,517,121 - 60,517,387	UniSTS	Rnor5.0
RGSC_v3.4	13	51,681,295 - 51,681,561	UniSTS	RGSC3.4
Celera	13	50,307,811 - 50,308,077	UniSTS
Cytogenetic Map	13	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000817 ⟹ ENSRNOP00000000817

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	52,573,730 - 52,700,823 (-)	Ensembl
mRatBN7.2 Ensembl	13	50,022,218 - 50,149,296 (-)	Ensembl
Rnor_6.0 Ensembl	13	55,488,585 - 55,561,726 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090162 ⟹ ENSRNOP00000069169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	52,573,730 - 52,700,823 (-)	Ensembl
mRatBN7.2 Ensembl	13	50,022,218 - 50,149,296 (-)	Ensembl
Rnor_6.0 Ensembl	13	55,488,531 - 55,561,750 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095155 ⟹ ENSRNOP00000086821

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	50,022,232 - 50,093,474 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098011 ⟹ ENSRNOP00000093817

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	52,573,730 - 52,630,115 (-)	Ensembl
mRatBN7.2 Ensembl	13	50,022,218 - 50,078,602 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000163858 ⟹ ENSRNOP00000106955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	52,575,649 - 52,700,823 (-)	Ensembl

RefSeq Acc Id:

NM_001108346 ⟹ NP_001101816

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	52,573,730 - 52,700,823 (-)	NCBI
mRatBN7.2	13	50,022,212 - 50,149,321 (-)	NCBI
Rnor_6.0	13	55,488,585 - 55,561,726 (-)	NCBI
Rnor_5.0	13	60,515,259 - 60,641,914 (-)	NCBI
RGSC_v3.4	13	51,679,191 - 51,942,636 (-)	RGD
Celera	13	50,308,775 - 50,377,141 (-)	NCBI

Sequence:

show sequence

ATGGATGAACAACCACAAGGAATGCAAGGGCCCCCTGTTCCTCAGTTCCAGCCGCAGAAGGCAT
TACGACCAGATATGGGCTATAATACTTTAGCCAACTTCCGAATAGAAAAGAAAATTGGACGTGG
ACAATTTAGTGAAGTTTATAGAGCATCCTGTCTCCTGGATGGAGTTCCAGTAGCTTTAAAAAAA
GTGCAGATATTTGATTTAATGGATGCCAAAGCACGTGCCGATTGTATCAAAGAAATAGATCTCC
TTAAGCAACTCAACCATCCAAATGTAATTAAATATTATGCATCATTCATTGAAGATAATGAGCT
GAACATAGTTTTGGAGTTAGCAGATGCTGGTGACCTCTCCAGAATGATAAAGCACTTTAAGAAA
CAAAAGAGGCTAATCCCTGAGAGGACTGTTTGGAAATACTTCGTTCAGCTCTGCAGTGCACTGG
ACCACATGCATTCTCGAAGAGTCATGCACAGAGATATAAAACCAGCTAATGTGTTCATTACAGC
CACTGGGGTAGTCAAACTTGGAGATCTTGGACTTGGTCGGTTCTTCAGCTCCAAAACCACAGCT
GCACATTCTTTAGTGGGCACGCCTTACTACATGTCTCCAGAGAGGATCCATGAGAACGGATACA
ACTTCAAGTCTGACATCTGGTCTCTCGGCTGTCTGCTGTATGAGATGGCGGCGTTGCAGAGTCC
TTTCTACGGAGACAAGATGAATCTGTACTCTCTGTGTAAGAAGATAGAACAGTGTGACTACCCA
CCTCTCCCATCAGATCACTATTCCGAGGAGCTCCGACAGTTAGTTAATATATGCATCAACCCAG
ATCCGGAGAAGCGACCGGACATCGCCTACGTTTATGATGTGGCAAAGAGGATGCATGCCTGTAC
CGCCAGCAGCTAA

hide sequence

RefSeq Acc Id:

XM_063272469 ⟹ XP_063128539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	52,573,736 - 52,663,412 (-)	NCBI

RefSeq Acc Id:

XM_063272470 ⟹ XP_063128540

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	52,573,736 - 52,700,869 (-)	NCBI

RefSeq Acc Id:

XM_063272471 ⟹ XP_063128541

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	52,573,736 - 52,627,724 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101816	(Get FASTA)	NCBI Sequence Viewer
	XP_063128539	(Get FASTA)	NCBI Sequence Viewer
	XP_063128540	(Get FASTA)	NCBI Sequence Viewer
	XP_063128541	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZBE5	(Get FASTA)	NCBI Sequence Viewer
	EDM09639	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000817
	ENSRNOP00000000817.4
	ENSRNOP00000093817

RefSeq Acc Id:

NP_001101816 ⟸ NM_001108346

- UniProtKB:

D3ZBE5 (UniProtKB/Swiss-Prot), A0A0G2JUP0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDEQPQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKK
VQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKK
QKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTA
AHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYP
PLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTASS

hide sequence

Ensembl Acc Id:

ENSRNOP00000069169 ⟸ ENSRNOT00000090162

Ensembl Acc Id:

ENSRNOP00000000817 ⟸ ENSRNOT00000000817

Ensembl Acc Id:

ENSRNOP00000093817 ⟸ ENSRNOT00000098011

Ensembl Acc Id:

ENSRNOP00000086821 ⟸ ENSRNOT00000095155

RefSeq Acc Id:	XP_063128540 ⟸ XM_063272470
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AKB8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128539 ⟸ XM_063272469
- Peptide Label:	isoform X1
- UniProtKB:	D3ZBE5 (UniProtKB/Swiss-Prot), A0A0G2JUP0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128541 ⟸ XM_063272471
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AKB8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000106955 ⟸ ENSRNOT00000163858

Protein Domains

Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZBE5-F1-model_v2	AlphaFold	D3ZBE5	1-302	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311160	AgrOrtholog
BioCyc Gene	G2FUF-18102	BioCyc
Ensembl Genes	ENSRNOG00000000657	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000817	ENTREZGENE
	ENSRNOT00000000817.7	UniProtKB/Swiss-Prot
	ENSRNOT00000098011	ENTREZGENE
Gene3D-CATH	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser-Thr/Tyr_kinase_cat_dom	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
KEGG Report	rno:360850	UniProtKB/Swiss-Prot
NCBI Gene	360850	ENTREZGENE
PANTHER	MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 20-RELATED	UniProtKB/Swiss-Prot
	SERINE/THREONINE-PROTEIN KINASE NEK7	UniProtKB/Swiss-Prot
Pfam	Pkinase	UniProtKB/Swiss-Prot
PhenoGen	Nek7	PhenoGen
PIRSF	Integrin-linked_kinase	UniProtKB/Swiss-Prot
PRINTS	TYRKINASE	UniProtKB/Swiss-Prot
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000657	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot
UniProt	A0A0G2JUP0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AKB8	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LMP7_RAT	UniProtKB/TrEMBL
	D3ZBE5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-11-21	Nek7	NIMA-related kinase 7	Nek7	NIMA (never in mitosis gene a)-related kinase 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Nek7	NIMA (never in mitosis gene a)-related kinase 7	Nek7	NIMA (never in mitosis gene a)-related expressed kinase 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Nek7	NIMA (never in mitosis gene a)-related expressed kinase 7	Nek7_predicted	NIMA (never in mitosis gene a)-related expressed kinase 7 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Nek7_predicted	NIMA (never in mitosis gene a)-related expressed kinase 7 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD