Advanced Search (OLGA)

Gene: Snrpb2 (small nuclear ribonucleoprotein polypeptide B2) Rattus norvegicus

Analyze

Symbol:

Snrpb2

Name:

small nuclear ribonucleoprotein polypeptide B2

RGD ID:

1310194

Description:

Enables snRNP binding activity. Predicted to be involved in mRNA splicing, via spliceosome. Part of small nuclear ribonucleoprotein complex. Human ortholog(s) of this gene implicated in connective tissue disease. Orthologous to human SNRPB2 (small nuclear ribonucleoprotein polypeptide B2); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; finasteride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC362223; small nuclear ribonucleoprotein polypeptide B''; U2 small nuclear ribonucleoprotein B; U2 small nuclear ribonucleoprotein B''

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Snrpb2 (U2 small nuclear ribonucleoprotein B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Snrpb2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Snrpb2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Snrpb2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Snrpb2 (small nuclear ribonucleoprotein polypeptide B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SNRPA (small nuclear ribonucleoprotein polypeptide A)	HGNC	Inparanoid
Alliance orthologs ³
Homo sapiens (human):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SNRPB2 (small nuclear ribonucleoprotein polypeptide B2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Snrpb2 (U2 small nuclear ribonucleoprotein B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Snrpb2 (U2 small nuclear ribonucleoprotein B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	snrpb2 (small nuclear ribonucleoprotein polypeptide B2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MSL1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	MSL1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rnp-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rnp-2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rnp-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rnp-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	snf	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	snf	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	snrpb2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	snrpb2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	150,852,814 - 150,862,364 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	150,852,790 - 150,863,428 (+)	Ensembl				GRCr8
mRatBN7.2	3	130,399,239 - 130,408,821 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	130,399,248 - 130,408,812 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	134,305,346 - 134,314,827 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	142,889,384 - 142,898,865 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	140,592,551 - 140,602,032 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	137,138,082 - 137,147,575 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	137,137,980 - 137,147,575 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	143,580,454 - 143,589,947 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	131,416,677 - 131,426,007 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	129,321,277 - 129,330,597 (+)	NCBI		Celera
RGSC_v3.1	3	131,322,233 - 131,331,711 (+)	NCBI
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

connective tissue disease (ISO)

disease of cellular proliferation (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carmustine (ISO)

CGP 52608 (ISO)

copper atom (ISO)

copper(0) (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

disulfiram (ISO)

diuron (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

genistein (EXP)

gentamycin (EXP)

gold atom (ISO)

gold(0) (ISO)

hydralazine (ISO)

indometacin (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nickel sulfate (ISO)

nobiletin (ISO)

ozone (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pinosylvin (ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

thiram (ISO)

tolcapone (EXP)

trans-pinosylvin (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

mRNA processing (IEA)

mRNA splicing, via spliceosome (IBA,ISO)

RNA splicing (IEA)

Cellular Component

catalytic step 2 spliceosome (ISO)

nuclear speck (ISO)

nucleus (IEA,ISO)

post-mRNA release spliceosomal complex (ISO)

post-spliceosomal complex (ISO)

precatalytic spliceosome (ISO)

ribonucleoprotein complex (IEA)

small nuclear ribonucleoprotein complex (IDA)

spliceosomal complex (IEA,ISO)

spliceosomal snRNP complex (IEA)

U1 snRNP (IBA)

U2 snRNP (ISO)

U2-type catalytic step 1 spliceosome (ISO)

U2-type catalytic step 2 spliceosome (ISO)

U2-type precatalytic spliceosome (ISO)

U2-type spliceosomal complex (ISO)

Molecular Function

nucleic acid binding (IEA)

protein binding (IPI,ISO)

RNA binding (IEA)

snRNP binding (IDA)

U1 snRNA binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

spliceosome pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.	Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.	The U2 small nuclear ribonucleoprotein particle as an autoantigen. Analysis with sera from patients with overlap syndromes.	Craft J, etal., J Clin Invest. 1988 Jun;81(6):1716-24.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	A novel 40S multi-snRNP complex isolated from rat liver nuclei.	Guialis A, etal., Nucleic Acids Res. 1991 Jan 25;19(2):287-96.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Molecular signature of MT1-MMP: transactivation of the downstream universal gene network in cancer.	Rozanov DV, etal., Cancer Res. 2008 Jun 1;68(11):4086-96. doi: 10.1158/0008-5472.CAN-07-6458.

Additional References at PubMed

PMID:2951739	PMID:9731529	PMID:11991638	PMID:12477932	PMID:28076346	PMID:28781166	PMID:30361391

Genomics

Comparative Map Data

Snrpb2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	150,852,814 - 150,862,364 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	150,852,790 - 150,863,428 (+)	Ensembl				GRCr8
mRatBN7.2	3	130,399,239 - 130,408,821 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	130,399,248 - 130,408,812 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	134,305,346 - 134,314,827 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	142,889,384 - 142,898,865 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	140,592,551 - 140,602,032 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	137,138,082 - 137,147,575 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	137,137,980 - 137,147,575 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	143,580,454 - 143,589,947 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	131,416,677 - 131,426,007 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	129,321,277 - 129,330,597 (+)	NCBI		Celera
RGSC_v3.1	3	131,322,233 - 131,331,711 (+)	NCBI
Cytogenetic Map	3	q41	NCBI

SNRPB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	16,730,026 - 16,742,564 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	16,729,958 - 16,742,564 (+)	Ensembl			hg38	GRCh38
GRCh37	20	16,710,671 - 16,723,209 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	16,658,629 - 16,670,037 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	16,658,628 - 16,670,037	NCBI
Celera	20	16,785,672 - 16,797,480 (+)	NCBI		Celera
Cytogenetic Map	20	p12.1	NCBI
HuRef	20	16,673,454 - 16,685,262 (+)	NCBI		HuRef
CHM1_1	20	16,710,624 - 16,722,432 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	16,781,147 - 16,793,686 (+)	NCBI		T2T-CHM13v2.0

Snrpb2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	142,904,989 - 142,913,972 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	142,904,959 - 142,914,773 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	143,063,069 - 143,072,052 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	143,063,039 - 143,072,853 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	142,888,805 - 142,897,788 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	142,754,510 - 142,763,493 (+)	NCBI		MGSCv36	mm8
Celera	2	144,238,085 - 144,247,080 (+)	NCBI		Celera
Cytogenetic Map	2	G1	NCBI
cM Map	2	70.89	NCBI

Snrpb2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	25,879,983 - 25,890,707 (+)	Ensembl
ChiLan1.0	NW_004955415	25,880,013 - 25,889,295 (+)	NCBI	ChiLan1.0	ChiLan1.0

SNRPB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	17,620,443 - 17,631,855 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	17,617,281 - 17,628,679 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	16,690,562 - 16,701,964 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	16,670,823 - 16,682,418 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	16,670,826 - 16,682,418 (+)	Ensembl			panPan2	panpan1.1

SNRPB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	6,106,217 - 6,117,369 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	6,106,217 - 6,117,369 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	5,972,930 - 5,984,084 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	6,512,414 - 6,523,916 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	6,512,769 - 6,523,916 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	6,121,887 - 6,133,032 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	6,218,271 - 6,229,422 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	6,494,619 - 6,505,772 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Snrpb2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	154,864,984 - 154,874,634 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	3,296,353 - 3,305,984 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	3,296,350 - 3,305,985 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SNRPB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	25,363,167 - 25,373,281 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	25,363,107 - 25,373,289 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	97,022,361 - 97,023,045 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SNRPB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	45,654,264 - 45,666,073 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	45,654,285 - 45,667,736 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	6,037,211 - 6,049,622 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snrpb2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	17,892,964 - 17,902,321 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624741	17,892,908 - 17,902,321 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Snrpb2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	122,545,011 - 122,555,085 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Snrpb2
26 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	17
Count of miRNA genes:	14
Interacting mature miRNAs:	17
Transcripts:	ENSRNOT00000006900
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	141555229	186555229	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141555229	186555229	Rat
1582233	Insul10	Insulin level QTL 10	5.4	0.0015	blood insulin amount (VT:0001560)	serum insulin level times blood glucose level (CMO:0002040)	3	133259579	178259579	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	141555229	186555229	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	141555229	186555229	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	129154923	182114333	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	141555229	186555229	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	141555229	186555229	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	133134628	178134628	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	141508991	166376254	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	112250810	157250810	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	142898802	187898802	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	145335553	189428310	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	117537367	162537367	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	110225882	155225882	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	136091420	155634702	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	139299381	184299381	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	141508991	177728348	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	131036586	176036586	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	137114333	182114333	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	131036586	176036586	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	110634702	155634702	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	141555229	186555229	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	144575244	189428310	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	116188400	161188400	Rat

Markers in Region

RH45368

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	130,401,544 - 130,401,673 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	137,140,354 - 137,140,482	NCBI	Rnor6.0
Rnor_5.0	3	143,582,726 - 143,582,854	UniSTS	Rnor5.0
RGSC_v3.4	3	131,418,945 - 131,419,073	UniSTS	RGSC3.4
Celera	3	129,323,543 - 129,323,671	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006235116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006900 ⟹ ENSRNOP00000006900

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	150,852,790 - 150,862,369 (+)	Ensembl
mRatBN7.2 Ensembl	3	130,399,258 - 130,408,809 (+)	Ensembl
Rnor_6.0 Ensembl	3	137,137,980 - 137,147,575 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097908 ⟹ ENSRNOP00000083310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	150,852,790 - 150,862,369 (+)	Ensembl
mRatBN7.2 Ensembl	3	130,399,248 - 130,408,812 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172496 ⟹ ENSRNOP00000100537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	150,853,066 - 150,863,428 (+)	Ensembl

RefSeq Acc Id:

NM_001108592 ⟹ NP_001102062

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	150,852,834 - 150,862,362 (+)	NCBI
mRatBN7.2	3	130,399,280 - 130,408,810 (+)	NCBI
Rnor_6.0	3	137,138,082 - 137,147,566 (+)	NCBI
Rnor_5.0	3	143,580,454 - 143,589,947 (+)	NCBI
RGSC_v3.4	3	131,416,677 - 131,426,007 (+)	RGD
Celera	3	129,321,277 - 129,330,597 (+)	RGD

Sequence:

show sequence

AGCTTCAAGCGGACCGCGCCGGCTTCAGGCTACTTGAAGAGTTTTACCCAAACATGGATATCAG
ACCAAATCACACGATTTATATCAACAACATGAATGACAAAATTAAAAAAGAAGAATTGAAGAGA
TCCCTGTATGCCCTGTTTTCTCAGTTTGGACATGTGGTAGATATTGTGGCTTTAAAGACCATGA
AGATGAGAGGGCAGGCTTTTGTTATATTTAAGGAACTGGGCTCATCCACAAATGCTTTGAGACA
GTTACAAGGATTTCCATTTTATGGTAAACCAATGAGAATTCAGTACGCAAAAACAGATTCCGAT
ATAATATCTAAAATGCGTGGTACTTTCGCTGACAAGGAAAAGAAAAAGGAAAAGAAGAAAGCTA
AAACCATGGAACAGGCTGCAGCAGCTGCAAACAAGAAGCCTGGTCAGGGAACACCAAATTCAGC
TAATACTCAAGGAAATGCAGCACCAAATCCTCAGGTCCCTGATTACCCTCCAAACTATATCCTG
TTCCTTAATAACTTACCAGAAGAGACGAATGAGATGATGTTATCCATGTTGTTCAACCAGTTCC
CTGGTTTCAAGGAAGTTCGCCTGGTCCCGGGGAGACATGATATTGCGTTTGTAGAATTTGAAAA
TGATGGGCAGGCTGGAGCAGCCAGAGATGCTCTGCAAGGGTTTAAGATCACACCATCCCATGCC
ATGAAGATTACCTATGCCAAGAAGTAACACGGGGAGTGCCAGTTTTAAAGGACTTGGTATTATT
TATAGCTTTTGTTTTAATTATATTCAGTCAAGTTGTTTGAAATGGTTGGAAGTGAAGGTGAAGT
TTTGGAAAAAGAGTCACCTAATTTTTTTTAGTTTTGGTGAACTATGAAATACAAAGCCTTAATT
TTGTACAATAAACTTTTATTTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105469 ⟹ XP_038961397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	150,852,814 - 150,862,364 (+)	NCBI
mRatBN7.2	3	130,399,456 - 130,408,821 (+)	NCBI

RefSeq Acc Id:

XM_039105470 ⟹ XP_038961398

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	150,853,294 - 150,862,364 (+)	NCBI
mRatBN7.2	3	130,399,239 - 130,408,819 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102062	(Get FASTA)	NCBI Sequence Viewer
	XP_038961397	(Get FASTA)	NCBI Sequence Viewer
	XP_038961398	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68760	(Get FASTA)	NCBI Sequence Viewer
	EDL95190	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006900
	ENSRNOP00000006900.4
	ENSRNOP00000083310.1
	ENSRNOP00000100537
	ENSRNOP00000100537.1

RefSeq Acc Id:

NP_001102062 ⟸ NM_001108592

- UniProtKB:

B5DEQ4 (UniProtKB/TrEMBL), F7EX25 (UniProtKB/TrEMBL), A0A8I6GAM2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTN
ALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTMEQAAAAANKKPGQGT
PNSANTQGNAAPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFV
EFENDGQAGAARDALQGFKITPSHAMKITYAKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000006900 ⟸ ENSRNOT00000006900

RefSeq Acc Id:	XP_038961398 ⟸ XM_039105470
- Peptide Label:	isoform X2
- UniProtKB:	B5DEQ4 (UniProtKB/TrEMBL), F7EX25 (UniProtKB/TrEMBL), A0A8I6GAM2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961397 ⟸ XM_039105469
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GAM2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083310 ⟸ ENSRNOT00000097908

Ensembl Acc Id:

ENSRNOP00000100537 ⟸ ENSRNOT00000172496

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DEQ4-F1-model_v2	AlphaFold	B5DEQ4	1-225	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692476

Promoter ID:

EPDNEW_R3000

Type:

initiation region

Name:

Snrpb2_1

Description:

small nuclear ribonucleoprotein polypeptide B2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	137,138,050 - 137,138,110	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310194	AgrOrtholog
BioCyc Gene	G2FUF-47633	BioCyc
Ensembl Genes	ENSRNOG00000004967	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006900	ENTREZGENE
	ENSRNOT00000006900.9	UniProtKB/TrEMBL
	ENSRNOT00000097908.2	UniProtKB/TrEMBL
	ENSRNOT00000172496	ENTREZGENE
	ENSRNOT00000172496.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/TrEMBL
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/TrEMBL
	RRM_RNP1	UniProtKB/TrEMBL
	U2B''_RRM1	UniProtKB/TrEMBL
	U2B''_RRM2	UniProtKB/TrEMBL
KEGG Report	rno:362223	UniProtKB/TrEMBL
NCBI Gene	362223	ENTREZGENE
PANTHER	U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A/U2 SMALL NUCLEAR RIBONUCLEOPROTEIN B	UniProtKB/TrEMBL
Pfam	RRM_1	UniProtKB/TrEMBL
PhenoGen	Snrpb2	PhenoGen
PROSITE	RRM	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004967	RatGTEx
SMART	RRM	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/TrEMBL
UniProt	A0A8I6GAM2	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0KZ46_RAT	UniProtKB/TrEMBL
	B5DEQ4	ENTREZGENE, UniProtKB/TrEMBL
	F7EX25	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Snrpb2	small nuclear ribonucleoprotein polypeptide B2	Snrpb2	small nuclear ribonucleoprotein polypeptide B''	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Snrpb2	small nuclear ribonucleoprotein polypeptide B''	Snrpb2	U2 small nuclear ribonucleoprotein B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Snrpb2	U2 small nuclear ribonucleoprotein B	Snrpb2_predicted	U2 small nuclear ribonucleoprotein B (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Snrpb2_predicted	U2 small nuclear ribonucleoprotein B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)