Symbol:
Klf1
Name:
KLF transcription factor 1
RGD ID:
1309398
Description:
Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and ubiquitin binding activity. Involved in cellular response to endothelin and maternal process involved in female pregnancy. Predicted to be located in chromatin and nucleoplasm. Human ortholog(s) of this gene implicated in congenital dyserythropoietic anemia type IVa and congenital dyserythropoietic anemia type IVb. Orthologous to human KLF1 (KLF transcription factor 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
erythroid Kruppel-like factor; Krueppel-like factor 1; Kruppel like factor 1; Kruppel-like factor 1 (erythroid); LOC304666
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 40,155,476 - 40,158,651 (-) NCBI GRCr8 mRatBN7.2 19 23,250,627 - 23,253,802 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 23,250,631 - 23,253,758 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 30,073,549 - 30,076,720 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 30,727,909 - 30,731,080 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 32,950,597 - 32,953,768 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 26,016,289 - 26,019,557 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 26,016,382 - 26,019,553 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,991,935 - 36,995,180 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 24,906,887 - 24,910,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 24,912,048 - 24,914,837 (-) NCBI Celera 19 22,807,529 - 22,810,700 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Klf1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KLF1 mRNA CTD PMID:32145629 Klf1 Rat 17beta-estradiol increases expression ISO Klf1 (Mus musculus) 6480464 Estradiol results in increased expression of KLF1 mRNA CTD PMID:39298647 Klf1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Klf1 (Mus musculus) 6480464 [NR1I2 protein affects the susceptibility to 2 more ... CTD PMID:32352317 Klf1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Klf1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Klf1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Klf1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with AHR gene mutant form] results in decreased expression of KLF1 mRNA CTD PMID:19465110 Klf1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Klf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLF1 mRNA CTD PMID:21354282 and PMID:37172768 Klf1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KLF1 mRNA CTD PMID:22298810 Klf1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Klf1 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Klf1 Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of KLF1 mRNA CTD PMID:30071829 Klf1 Rat 4,4'-sulfonyldiphenol increases expression ISO Klf1 (Mus musculus) 6480464 bisphenol S results in increased expression of KLF1 mRNA CTD PMID:39298647 Klf1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KLF1 mRNA CTD PMID:30047161 Klf1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of KLF1 mRNA CTD PMID:28959563 Klf1 Rat acrylamide decreases expression ISO Klf1 (Mus musculus) 6480464 Acrylamide results in decreased expression of KLF1 mRNA CTD PMID:30807115 Klf1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KLF1 mRNA CTD PMID:30047161 Klf1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of KLF1 mRNA CTD PMID:36841081 Klf1 Rat benzo[a]pyrene decreases expression ISO Klf1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of KLF1 mRNA CTD PMID:17942131 Klf1 Rat benzo[a]pyrene increases methylation ISO KLF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KLF1 promoter CTD PMID:27901495 Klf1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KLF1 mRNA CTD PMID:25181051 and PMID:34947998 Klf1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KLF1 mRNA CTD PMID:32145629 Klf1 Rat bisphenol A affects methylation ISO Klf1 (Mus musculus) 6480464 bisphenol A affects the methylation of KLF1 promoter CTD PMID:27334623 Klf1 Rat bisphenol A increases expression ISO KLF1 (Homo sapiens) 6480464 bisphenol A results in increased expression of KLF1 mRNA CTD PMID:31715268 Klf1 Rat Butylbenzyl phthalate decreases expression ISO Klf1 (Mus musculus) 6480464 butylbenzyl phthalate results in decreased expression of KLF1 mRNA CTD PMID:32308655 Klf1 Rat cadmium atom multiple interactions ISO KLF1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KLF1 mRNA CTD PMID:35301059 Klf1 Rat cadmium dichloride decreases expression ISO Klf1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of KLF1 mRNA CTD PMID:24982889 Klf1 Rat cadmium dichloride multiple interactions ISO KLF1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KLF1 mRNA CTD PMID:35301059 Klf1 Rat cadmium dichloride increases expression ISO Klf1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of KLF1 mRNA CTD PMID:24982889 Klf1 Rat capsaicin increases expression ISO Klf1 (Mus musculus) 6480464 Capsaicin results in increased expression of KLF1 mRNA CTD PMID:17603282 Klf1 Rat cyclosporin A decreases expression ISO Klf1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of KLF1 mRNA CTD PMID:17942131 Klf1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of KLF1 mRNA CTD PMID:29391264 Klf1 Rat hydrogen peroxide increases expression ISO KLF1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of KLF1 mRNA CTD PMID:18951874 Klf1 Rat lipopolysaccharide increases expression ISO Klf1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of KLF1 mRNA CTD PMID:12057914 Klf1 Rat MeIQx increases expression ISO KLF1 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Klf1 Rat N-nitrosodiethylamine decreases expression ISO Klf1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of KLF1 mRNA CTD PMID:24535843 Klf1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of KLF1 mRNA CTD PMID:33484710 Klf1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of KLF1 mRNA CTD PMID:25729387 Klf1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of KLF1 mRNA CTD PMID:25729387 Klf1 Rat paracetamol affects expression ISO Klf1 (Mus musculus) 6480464 Acetaminophen affects the expression of KLF1 mRNA CTD PMID:17562736 Klf1 Rat paracetamol decreases expression ISO Klf1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of KLF1 mRNA CTD PMID:17942131 Klf1 Rat phenobarbital increases expression ISO Klf1 (Mus musculus) 6480464 Phenobarbital results in increased expression of KLF1 mRNA CTD PMID:19270015 Klf1 Rat pirinixic acid multiple interactions ISO Klf1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of KLF1 mRNA CTD PMID:19710929 Klf1 Rat pomalidomide decreases expression ISO KLF1 (Homo sapiens) 6480464 pomalidomide results in decreased expression of KLF1 mRNA CTD PMID:15292067 Klf1 Rat resveratrol multiple interactions ISO KLF1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of KLF1 mRNA CTD PMID:23557933 Klf1 Rat sodium arsenite decreases expression ISO Klf1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of KLF1 mRNA CTD PMID:35961411 Klf1 Rat tetrachloromethane decreases expression ISO Klf1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of KLF1 mRNA CTD PMID:31919559 Klf1 Rat titanium dioxide increases methylation ISO Klf1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of KLF1 gene CTD PMID:35295148 Klf1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of KLF1 mRNA CTD PMID:25729387 Klf1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of KLF1 mRNA CTD PMID:25729387 Klf1 Rat Tributyltin oxide decreases expression ISO Klf1 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of KLF1 mRNA CTD PMID:17942131 Klf1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of KLF1 mRNA CTD PMID:33387578 Klf1 Rat triclosan decreases expression ISO KLF1 (Homo sapiens) 6480464 Triclosan results in decreased expression of KLF1 mRNA CTD PMID:30510588 Klf1 Rat triptonide increases expression ISO Klf1 (Mus musculus) 6480464 triptonide results in increased expression of KLF1 mRNA CTD PMID:33045310 Klf1 Rat valproic acid increases methylation ISO KLF1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KLF1 gene CTD PMID:29154799
17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) amitrole (EXP) atrazine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) capsaicin (ISO) cyclosporin A (ISO) endosulfan (EXP) hydrogen peroxide (ISO) lipopolysaccharide (ISO) MeIQx (ISO) N-nitrosodiethylamine (ISO) nitrofen (EXP) oxaliplatin (EXP) paracetamol (ISO) phenobarbital (ISO) pirinixic acid (ISO) pomalidomide (ISO) resveratrol (ISO) sodium arsenite (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) triclosan (ISO) triptonide (ISO) valproic acid (ISO)
1.
Clinical significance of Gata-1, Gata-2, EKLF, and c-MPL expression in acute myeloid leukemia.
Ayala RM, etal., Am J Hematol. 2009 Feb;84(2):79-86. doi: 10.1002/ajh.21332.
2.
Pregnancy and lactation modulate maternal splenic growth and development of the erythroid lineage in the rat and mouse.
Bustamante JJ, etal., Reprod Fertil Dev. 2008;20(2):303-10.
3.
Differential regulation of Kruppel-like factor family transcription factor expression in neonatal rat cardiac myocytes: effects of endothelin-1, oxidative stress and cytokines.
Cullingford TE, etal., Biochim Biophys Acta. 2008 Jun;1783(6):1229-36. Epub 2008 Mar 25.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Mutation in erythroid specific transcription factor KLF1 causes Hereditary Spherocytosis in the Nan hemolytic anemia mouse model.
Heruth DP, etal., Genomics. 2010 Nov;96(5):303-7. doi: 10.1016/j.ygeno.2010.07.009. Epub 2010 Aug 5.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Transcription factors Fli1 and EKLF in the differentiation of megakaryocytic and erythroid progenitor in 5q- syndrome and in Diamond-Blackfan anemia.
Neuwirtova R, etal., Ann Hematol. 2013 Jan;92(1):11-8. doi: 10.1007/s00277-012-1568-1. Epub 2012 Sep 11.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
Expression profiling of CD34+ hematopoietic stem/ progenitor cells reveals distinct subtypes of therapy-related acute myeloid leukemia.
Qian Z, etal., Proc Natl Acad Sci U S A. 2002 Nov 12;99(23):14925-30. Epub 2002 Nov 4.
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Klf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 40,155,476 - 40,158,651 (-) NCBI GRCr8 mRatBN7.2 19 23,250,627 - 23,253,802 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 23,250,631 - 23,253,758 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 30,073,549 - 30,076,720 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 30,727,909 - 30,731,080 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 32,950,597 - 32,953,768 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 26,016,289 - 26,019,557 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 26,016,382 - 26,019,553 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,991,935 - 36,995,180 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 24,906,887 - 24,910,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 24,912,048 - 24,914,837 (-) NCBI Celera 19 22,807,529 - 22,810,700 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
KLF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 12,884,422 - 12,887,201 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 12,884,422 - 12,887,201 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 12,995,236 - 12,998,015 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 12,856,236 - 12,859,017 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 12,856,238 - 12,859,017 NCBI Celera 19 12,884,944 - 12,887,725 (-) NCBI Celera Cytogenetic Map 19 p13.13 NCBI HuRef 19 12,567,102 - 12,569,883 (-) NCBI HuRef CHM1_1 19 12,995,734 - 12,998,515 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 13,008,871 - 13,011,650 (-) NCBI T2T-CHM13v2.0
Klf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 85,628,611 - 85,631,920 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 85,628,557 - 85,631,924 (+) Ensembl GRCm39 Ensembl GRCm38 8 84,901,982 - 84,905,291 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 84,901,928 - 84,905,295 (+) Ensembl GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 84,901,928 - 84,905,291 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 87,425,827 - 87,429,194 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 87,792,033 - 87,795,396 (+) NCBI MGSCv36 mm8 Celera 8 89,201,315 - 89,204,684 (+) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 41.3 NCBI
Klf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 31,939,873 - 31,943,545 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 31,939,994 - 31,943,539 (-) NCBI ChiLan1.0 ChiLan1.0
KLF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 17,813,004 - 17,816,281 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 16,813,599 - 16,816,877 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 12,446,130 - 12,449,238 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 13,188,652 - 13,191,425 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 13,188,652 - 13,191,425 (-) Ensembl panpan1.1 panPan2
KLF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 49,295,097 - 49,298,668 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 49,295,195 - 49,298,602 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 49,167,333 - 49,170,856 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 49,812,012 - 49,815,534 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 49,812,065 - 49,815,535 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 49,023,330 - 49,026,851 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 49,449,814 - 49,453,336 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 49,692,152 - 49,695,675 (+) NCBI UU_Cfam_GSD_1.0
Klf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 208,405,121 - 208,408,019 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 1,947,075 - 1,950,003 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 1,946,614 - 1,950,003 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KLF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 66,144,777 - 66,148,517 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 66,144,767 - 66,148,500 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 66,451,872 - 66,455,605 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KLF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 11,563,773 - 11,566,615 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 11,564,235 - 11,566,495 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 8,215,420 - 8,223,612 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Klf1
.
Predicted Target Of
Count of predictions: 59 Count of miRNA genes: 52 Interacting mature miRNAs: 57 Transcripts: ENSRNOT00000004601 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
Klf1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,250,812 - 23,252,370 (-) MAPPER mRatBN7.2 Rnor_6.0 19 26,017,814 - 26,019,371 NCBI Rnor6.0 Rnor_5.0 19 36,993,437 - 36,994,994 UniSTS Rnor5.0 RGSC_v3.4 19 24,907,069 - 24,908,626 UniSTS RGSC3.4 Celera 19 22,807,711 - 22,809,268 UniSTS Cytogenetic Map 19 q11 UniSTS
Klf1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 40,157,791 - 40,158,525 (+) Marker Load Pipeline mRatBN7.2 19 23,252,942 - 23,253,676 (-) MAPPER mRatBN7.2 Rnor_6.0 19 26,016,508 - 26,017,241 NCBI Rnor6.0 Rnor_5.0 19 36,992,131 - 36,992,864 UniSTS Rnor5.0 Celera 19 22,809,841 - 22,810,574 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004601 ⟹ ENSRNOP00000004601
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,250,633 - 23,253,758 (-) Ensembl Rnor_6.0 Ensembl 19 26,016,382 - 26,019,553 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107650 ⟹ ENSRNOP00000079985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,250,631 - 23,253,614 (-) Ensembl
RefSeq Acc Id:
NM_001107164 ⟹ NP_001100634
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,155,480 - 40,158,651 (-) NCBI mRatBN7.2 19 23,250,631 - 23,253,802 (-) NCBI Rnor_6.0 19 26,016,382 - 26,019,553 (+) NCBI Rnor_5.0 19 36,991,935 - 36,995,180 (+) NCBI RGSC_v3.4 19 24,906,887 - 24,910,058 (-) RGD Celera 19 22,807,529 - 22,810,700 (-) RGD
Sequence:
GTGGGCAGACAGGAGCCCTCCAAGGAACCTTCCTAGCCTCATAGCCCATGAGGCAGAAGAGAGAGAGGAGGCCTGAGGCCCAGGGTGGACAGCAGCCAGTCATGGCCTCAGCTGAGACTGTCTTACCC
hide sequence
RefSeq Acc Id:
XM_006255254 ⟹ XP_006255316
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,155,476 - 40,158,633 (-) NCBI mRatBN7.2 19 23,250,627 - 23,253,770 (-) NCBI Rnor_6.0 19 26,016,289 - 26,019,557 (+) NCBI Rnor_5.0 19 36,991,935 - 36,995,180 (+) NCBI
Sequence:
AAAAAAAAAGACACACGGCACACTCATATCACACACACCCTCCTTCGCCTTTTGCCTTGCCAGAGTCTTATCAGAGAAGACAGCCAATCAGATGTGGGCAGACAGGAGCCCTCCAAGGAACCTTCCTA
hide sequence
RefSeq Acc Id:
NP_001100634 ⟸ NM_001107164
- UniProtKB:
A6IY63 (UniProtKB/TrEMBL), B0BNN2 (UniProtKB/TrEMBL)
- Sequence:
MRQKRERRPEAQGGQQPVMASAETVLPSISTLTTLGQFLDTQEDFLKWWRSEETQDLGPGPPNPTEPSFHVSLKSEDPPGEDDERDVTCAWDPDLFLTNFSGPEPPSTPRTCALAPSGGPVAQFAPPE
hide sequence
RefSeq Acc Id:
XP_006255316 ⟸ XM_006255254
- Peptide Label:
isoform X1
- UniProtKB:
B0BNN2 (UniProtKB/TrEMBL)
- Sequence:
MRQKRERRPEAQGGQQPVMASAETVLPSISTLTTLGQFLDTQEDFLKWWRSEETQDLGPGPPNPTEPSFHVSLKSEDPPGEDDERDVTCAWDPDLFLTNFSGPEPPSTPRTCALAPSGGPVAQFAPPE
hide sequence
Ensembl Acc Id:
ENSRNOP00000004601 ⟸ ENSRNOT00000004601
Ensembl Acc Id:
ENSRNOP00000079985 ⟸ ENSRNOT00000107650
RGD ID: 13701028 Promoter ID: EPDNEW_R11552 Type: single initiation site Name: Klf1_1 Description: Kruppel like factor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 26,016,434 - 26,016,494 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-10-03
Klf1
KLF transcription factor 1
Klf1
Kruppel like factor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-06-08
Klf1
Kruppel like factor 1
Klf1
Kruppel-like factor 1 (erythroid)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Klf1
Kruppel-like factor 1 (erythroid)
Klf1_predicted
Kruppel-like factor 1 (erythroid) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Klf1_predicted
Kruppel-like factor 1 (erythroid) (predicted)
Symbol and Name status set to approved
70820 APPROVED
