Advanced Search (OLGA)

Gene: Ddx4 (DEAD-box helicase 4) Rattus norvegicus

Analyze

Symbol:

Ddx4

Name:

DEAD-box helicase 4

RGD ID:

1308793

Description:

Predicted to enable several functions, including ATP hydrolysis activity; RNA helicase activity; and molecular condensate scaffold activity. Involved in response to benzoic acid; response to retinoic acid; and spermatogenesis. Located in chromatoid body and perinuclear region of cytoplasm. Orthologous to human DDX4 (DEAD-box helicase 4); INTERACTS WITH 17alpha-ethynylestradiol; 3-chloropropane-1,2-diol; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DEAD (Asp-Glu-Ala-Asp) box polypeptide 4; DEAD box protein 4; LOC310090; probable ATP-dependent RNA helicase DDX4; putative ATP-dependent RNA helicase DDX4; RVLG; vasa homolog; vasa-like gene protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX4 (DEAD-box helicase 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Ddx4 (DEAD box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ddx4 (DEAD-box helicase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADK (adenosine kinase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DDX4 (DEAD-box helicase 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DDX4 (DEAD-box helicase 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ddx4 (DEAD box helicase 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glh-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	glh-1	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)
Caenorhabditis elegans (roundworm):	glh-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	vas	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	glh-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	glh-3	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ddx4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	45,961,174 - 46,016,097 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	45,961,174 - 46,015,951 (-)	Ensembl				GRCr8
mRatBN7.2	2	44,227,946 - 44,282,867 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	44,227,946 - 44,282,723 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	51,343,866 - 51,398,222 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	49,402,306 - 49,456,662 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	44,274,677 - 44,329,399 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	44,447,610 - 44,504,263 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	44,447,573 - 44,504,354 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	63,489,384 - 63,545,657 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	43,964,552 - 44,022,919 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	40,006,460 - 40,062,288 (-)	NCBI		Celera
RGSC_v3.1	2	43,783,992 - 43,955,157 (-)	NCBI
Cytogenetic Map	2	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

male infertility (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

7,12-dimethyltetraphene (ISO)

acetic acid (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (EXP)

alpha-naphthoflavone (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bromochloroacetic acid (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

cypermethrin (ISO)

D-glucose (ISO)

dibutyl phthalate (ISO)

dimethomorph (EXP)

diquat (ISO)

glucose (ISO)

linuron (EXP)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (EXP,ISO)

N(4)-hydroxycytidine (ISO)

Nonylphenol (ISO)

ozone (ISO)

paclitaxel (EXP)

paracetamol (ISO)

resmethrin (ISO)

rotenone (EXP)

sodium arsenite (ISO)

tamoxifen (ISO)

thiacloprid (ISO)

titanium dioxide (ISO)

triphenylstannane (EXP)

triptonide (ISO)

valproic acid (ISO)

zearalenone (ISO)

zinc oxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IBA,IEA)

flagellated sperm motility (IEA,ISO)

gamete generation (IBA)

germ cell development (IBA)

male meiosis I (ISO,ISS)

male meiotic nuclear division (ISO,ISS)

meiotic cell cycle (IEA)

piRNA processing (ISO,ISS)

regulation of protein localization (ISO)

regulatory ncRNA-mediated gene silencing (IEA)

response to benzoic acid (IEP)

response to retinoic acid (HEP,IEP)

secondary piRNA processing (ISO)

spermatogenesis (IEA,IEP,ISO,ISS)

transposable element silencing by piRNA-mediated DNA methylation (ISO,ISS)

transposable element silencing by piRNA-mediated heterochromatin formation (ISO,ISS)

Cellular Component

chromatoid body (IDA,IEA,ISO)

cytoplasm (IEA,ISO,ISS)

nucleus (IBA,ISO)

P granule (IBA)

perinuclear region of cytoplasm (IDA,IEA,ISO)

pi-body (ISO,ISS)

piP-body (ISO,ISS)

ribonucleoprotein complex (ISO)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA,ISO,ISS)

helicase activity (IEA)

hydrolase activity (IEA)

molecular condensate scaffold activity (ISO)

mRNA binding (IBA)

nucleic acid binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

RNA helicase activity (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	DDX6 localizes to nuage structures and the annulus of mammalian spermatogenic cells.	Kawahara C, etal., Histochem Cell Biol. 2014 Jan;141(1):111-21. doi: 10.1007/s00418-013-1153-2. Epub 2013 Oct 20.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	All-Trans Retinoic Acid Disrupts Development in Ex Vivo Cultured Fetal Rat Testes. I: Altered Seminiferous Cord Maturation and Testicular Cell Fate.	Spade DJ, etal., Toxicol Sci. 2019 Feb 1;167(2):546-558. doi: 10.1093/toxsci/kfy260.
7.	All-trans Retinoic Acid Disrupts Development in Ex Vivo Cultured Fetal Rat Testes. II: Modulation of Mono-(2-ethylhexyl) Phthalate Toxicity.	Spade DJ, etal., Toxicol Sci. 2019 Mar 1;168(1):149-159. doi: 10.1093/toxsci/kfy283.

Additional References at PubMed

PMID:7857296	PMID:10766740	PMID:10781947	PMID:12798292	PMID:14736746	PMID:15749075	PMID:15789443	PMID:17141210	PMID:20011505	PMID:20439430	PMID:21034600	PMID:21421998
PMID:21991325	PMID:22792342	PMID:22993404	PMID:28633017	PMID:32020412

Genomics

Comparative Map Data

Ddx4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	45,961,174 - 46,016,097 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	45,961,174 - 46,015,951 (-)	Ensembl				GRCr8
mRatBN7.2	2	44,227,946 - 44,282,867 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	44,227,946 - 44,282,723 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	51,343,866 - 51,398,222 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	49,402,306 - 49,456,662 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	44,274,677 - 44,329,399 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	44,447,610 - 44,504,263 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	44,447,573 - 44,504,354 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	63,489,384 - 63,545,657 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	43,964,552 - 44,022,919 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	40,006,460 - 40,062,288 (-)	NCBI		Celera
RGSC_v3.1	2	43,783,992 - 43,955,157 (-)	NCBI
Cytogenetic Map	2	q14	NCBI

DDX4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	55,738,061 - 55,817,157 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	55,738,017 - 55,817,157 (+)	Ensembl			hg38	GRCh38
GRCh37	5	55,033,889 - 55,112,985 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	55,070,533 - 55,148,362 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	55,070,532 - 55,148,363	NCBI
Celera	5	51,987,565 - 52,066,696 (+)	NCBI		Celera
Cytogenetic Map	5	q11.2	NCBI
HuRef	5	52,007,082 - 52,086,270 (+)	NCBI		HuRef
CHM1_1	5	55,038,024 - 55,117,130 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	56,566,349 - 56,645,450 (+)	NCBI		T2T-CHM13v2.0

Ddx4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	112,734,867 - 112,790,342 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	112,734,867 - 112,789,009 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	112,598,333 - 112,652,633 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	112,598,333 - 112,652,475 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	113,388,541 - 113,442,518 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	113,719,214 - 113,773,179 (-)	NCBI		MGSCv36	mm8
Celera	13	116,904,120 - 116,961,259 (-)	NCBI		Celera
Cytogenetic Map	13	D2.2	NCBI
cM Map	13	63.87	NCBI

Ddx4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955446	11,967,322 - 12,024,587 (-)	Ensembl
ChiLan1.0	NW_004955446	11,967,222 - 12,025,537 (-)	NCBI	ChiLan1.0	ChiLan1.0

DDX4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	58,113,528 - 58,200,655 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	56,265,561 - 56,354,287 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	58,202,037 - 58,286,518 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	59,828,631 - 59,910,684 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	59,827,031 - 59,910,681 (-)	Ensembl			panPan2	panpan1.1

DDX4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	43,026,367 - 43,109,546 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	43,027,296 - 43,109,526 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	40,072,766 - 40,155,910 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	43,492,081 - 43,575,330 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	43,491,353 - 43,663,722 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	40,569,844 - 40,653,361 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	41,371,493 - 41,456,022 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	42,192,815 - 42,275,988 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ddx4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	203,089,227 - 203,142,238 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	12,027,357 - 12,077,689 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	12,027,117 - 12,078,716 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	34,858,368 - 34,983,699 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	34,879,701 - 34,983,701 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	37,028,191 - 37,080,883 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	51,984,753 - 52,058,425 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	51,986,338 - 52,057,813 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	860,626 - 933,873 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	3,455,543 - 3,567,605 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624759	3,454,850 - 3,568,531 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ddx4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	184,132,822 - 184,438,014 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ddx4
249 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	48
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000013035
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	36750344	81750344	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1300160	Hrtrt3	Heart rate QTL 3	3.62		heart pumping trait (VT:2000009)	absolute change in heart rate (CMO:0000534)	2	35614083	53462005	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
9685065	Swd6	Spike wave discharge measurement QTL 6	5.8	0.01	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge rate (CMO:0001739)	2	40957423	50526673	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	28889991	73889991	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	44904355	85286097	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	83465677	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	36868643	81868643	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	44904355	89904355	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	33269996	78269996	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	73652666	Rat

Markers in Region

AV206478

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	44,228,017 - 44,228,116 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	44,447,682 - 44,447,780	NCBI	Rnor6.0
Rnor_5.0	2	63,489,456 - 63,489,554	UniSTS	Rnor5.0
RGSC_v3.4	2	43,964,624 - 43,964,722	UniSTS	RGSC3.4
Celera	2	40,006,532 - 40,006,630	UniSTS
Cytogenetic Map	2	q14	UniSTS

PMC208779P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	44,247,004 - 44,247,594 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	44,466,671 - 44,467,260	NCBI	Rnor6.0
Rnor_5.0	2	63,508,577 - 63,509,166	UniSTS	Rnor5.0
RGSC_v3.4	2	43,985,061 - 43,985,650	UniSTS	RGSC3.4
Celera	2	40,026,103 - 40,026,692	UniSTS
Cytogenetic Map	2	q14	UniSTS

Ddx4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	44,247,004 - 44,248,663 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	44,466,671 - 44,468,329	NCBI	Rnor6.0
Rnor_5.0	2	63,508,577 - 63,510,235	UniSTS	Rnor5.0
RGSC_v3.4	2	43,985,061 - 43,986,719	UniSTS	RGSC3.4
Celera	2	40,026,103 - 40,027,761	UniSTS
Cytogenetic Map	2	q14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
2	4	30	44	33	37	11	18	11	6	142	61	30	65	77	26	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590825	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590827	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	GQ243745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JQ013737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S75275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013035 ⟹ ENSRNOP00000013035

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	45,961,174 - 46,015,163 (-)	Ensembl
mRatBN7.2 Ensembl	2	44,227,946 - 44,281,942 (-)	Ensembl
Rnor_6.0 Ensembl	2	44,447,573 - 44,504,354 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108725 ⟹ ENSRNOP00000085415

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	45,961,174 - 46,015,951 (-)	Ensembl
mRatBN7.2 Ensembl	2	44,227,948 - 44,282,723 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117202 ⟹ ENSRNOP00000083389

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	45,961,174 - 46,015,951 (-)	Ensembl
mRatBN7.2 Ensembl	2	44,227,948 - 44,282,723 (-)	Ensembl

RefSeq Acc Id:

NM_001077647 ⟹ NP_001071115

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,951 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,730 (-)	NCBI
Rnor_6.0	2	44,447,610 - 44,504,146 (-)	NCBI
Rnor_5.0	2	63,489,384 - 63,545,657 (-)	NCBI
RGSC_v3.4	2	43,964,552 - 44,022,919 (-)	RGD
Celera	2	40,006,460 - 40,062,288 (-)	RGD

Sequence:

show sequence

CTTGCTTCCAACCCTGGCTCAGGGCGTCCTAACCAGGCCCGGTAGCCTCTGGGGCAGACTTAGG
CCAGAGGCTGCTCACATGGGCCTGCCTGGGGCTTGAGGTCGGCCTCTGGGGCCTTCCCGCTCAG
ACTGGAGTCTTCATGCTGAGTAGAGCGGTGTGTGAACACTTGAGGCCTGCAGGGGAGGGAGGCC
CAGGGAACCTTCTGCTCAGCGCCTAGGCGGCCATTTCTCAGAAGAAACGGTGTTTGTGGAACCT
GAAGCTATCATGGGAGATGAAGATTGGGAGGCAGAAATCCTCAAACCTCATGTGTCTTCCTACG
TTCCTGTATTTGAGAAGGATAAATATTCTTCTGGGGCAAATGGAGACACTTTTAACAGGACTTC
AGCTTCATCATCAGAAATGGAAGATGGACCTTCTGGAAGAGATCATTTCATGAGAAGTGGATTT
TCCTCTGGAAGAAATTTAGGAAACAGAGATATTGGCGAGTCTAGTAAAAGAGAGACTACATCTA
CAACCGGTGGCTTTGGAAGAGGAAAGGGTTTTGGAAACAGAGGTTTTTTAAATAACAAGTTTGA
AGAAGGTGACAGCTCTGGTTTCTGGAAAGAGTCTACTAATGACTGTGAAGATACTCAGACTCGG
AGCAGAGGGTTTTCCAAGCGAGGCGGCTATCCAGATGGGAATGATTCGGAAGCTTCAGGCCCAT
TCAGAAGAGGTGGGAGAGATAGTGAATATGACCAAGATCAGGGATCACAGCGTGGTGGTGGCCT
TTTTGGTTCTAGGAAACCAGCAGCAAGTGATTCAGGCAGTGGTGACACTTTCCAGAGCAGAAGT
GGGAATGCCCGAGGTGCCTACAAAGGCTTAAATGAAGAAGTAGTAACAGGCTCTGGAAAGAATT
CTTGGAAGTCAGAAGCTGAAGGAGGCGAAAGCAGTGATATTCAAGGTCCAAAAGTGACATATAT
ACCCCCTCCTCCACCAGAGGATGAGGACTCCATCTTTGCACATTATCAGACAGGCATAAACTTT
GATAAATATGATACCATACTTGTTGAAGTATCTGGACATGATGCACCACCGGCAATTTTGACTT
TTGAAGAAGCGAATCTCTGCCAGACCCTGAATAACAACATTGCTAAGGCTGGCTATACCAAGCT
CACTCCTGTGCAGAAGTACAGCATTCCCATTGTGTTAGCAGGAAGAGATTTGATGGCTTGTGCT
CAAACAGGGTCTGGGAAGACGGCAGCTTTTCTCTTGCCTATTTTGGCTCATATGATGAGGGATG
GAATAACTGCCAGTCGCTTTAAAGAACTGCAGGAACCAGAGTGTATTATTGTAGCACCAACTCG
AGAATTGATCAACCAAATTTATTTGGAAGCCAGAAAATTTTCTTTTGGGACTTGTGTAAGAGCT
GTTGTCATATATGGAGGAACCCAGTTTGGGCACTCAATTCGACAGATAGTGCAAGGGTGTAATA
TATTATGTGCTACTCCAGGGAGGCTGATGGATATCATAGGCAAAGAAAAGATTGGTCTCAAACA
AGTCAAGTACTTAGTTTTGGATGAAGCTGATCGAATGTTGGATATGGGTTTTGGACCCGAAATG
AAGAAGTTAATTTCTTGTCCAGGAATGCCATCAAAGGAACAGCGCCAAACTCTCTTATTCAGTG
CAACTTTTCCAGAAGAAATCCAGAGGTTGGCTGGCGAGTTTTTAAAGTCAAATTATTTGTTTGT
TGCTGTTGGACAAGTGGGAGGAGCTTGCAGAGATGTGCAGCAGTCCATTCTTCAAGTTGGCCCA
GTATTCAAAAAGAGAAAACTTGTTGAGATTCTACGAAACATAGGTGATGAAAGACCTATGGTCT
TTGTTGAAACCAAGAAAAAAGCAGATTTCATTGCGACTTTCCTTTGTCAAGAAAAAATATCAAC
TACAAGTATTCATGGCGATCGGGAACAGAGGGAGCGAGAACAAGCTCTTGGAGATTTTCGCTGT
GGAAAGTGCCCAGTTCTTGTTGCTACTTCAGTGGCTGCCAGAGGACTTGATATTGAAAATGTTC
AACATGTTATCAATTTTAACCTTCCTTCTACCATTGATGAATATGTTCATCGAATTGGACGTAC
TGGACGTTGTGGAAATACTGGCAGGGCGATTTCTTTTTTTGATACCGAATCTGATAATCATTTA
GCACAACCTCTAGTTAAAGTACTGTCAGATGCTCAACAGGATGTTCCTGCGTGGTTAGAAGAGA
TTGCCTTTAGTTCATATGCGCCTCCCAGCTTCAGTAATAGCACAAGAGGGGCTGTGTTTGCATC
TTTTGACACTAGGAAGAATTTCCAGGGCAAGAACACACTGAACACAGCTGGGATTTCTTCTGCA
CAAGCTCCCAATCCAGTTGATGACGAGTCATGGGATTAAAGCAAACAAGCATACTGCAAGTCTG
ATGGTTTTGATGCAGAGAAGAAAAACAGTTTTTATTTTTAAAATTTTAACAGAAGTGTGAAACC
TGATATTCTTATATCTCCTGTTCTTCTGTTCTTACTCCCAACCCTTAAAAAATAACCAGCTTCA
TTGATTAGTTATGCGAAATGCTGAAGTTACAACATTGCAGTTACTGATACAAATGGTGTTCACT
GGAAATATTAAAGCATTCTATGTTTTGCTTATTTCTAGTATATTCTTCAGAAAGTTAAAGACAT
GTTTCATGTCCAAGTGCTATGTCTTAGTATAGTGTTTCTGATCTATAAAACAAGCAATAGGATA
TGGTGTACTCTTGTTTAATTATCGGGTCTAATTTCTACTTGATCCTTTAAAAGAATAGTGTGTC
AGTACAATGTATTAACATGATTTTCATGAAACAGTGGAGACTGAAGCCTTTCAAAGTTATTTGA
TTTTTAGATCATCAGACATGTAATGAAAATGGTTCAGTTTGCAATGTGAGCTCTGTACTTGGTG
GTATGACAAATGTTTGCTTTTATAATATACAGATTTTCCTTGGAAATAAAAGATGAAACACATT
TCCCCCTAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102182 ⟹ XP_038958110

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,016,097 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,867 (-)	NCBI

RefSeq Acc Id:

XM_039102183 ⟹ XP_038958111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,739 (-)	NCBI

RefSeq Acc Id:

XM_039102184 ⟹ XP_038958112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,016,096 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,865 (-)	NCBI

RefSeq Acc Id:

XM_039102185 ⟹ XP_038958113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,016,097 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,867 (-)	NCBI

RefSeq Acc Id:

XM_039102187 ⟹ XP_038958115

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,016,096 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,866 (-)	NCBI

RefSeq Acc Id:

XM_039102188 ⟹ XP_038958116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,016,097 (-)	NCBI
mRatBN7.2	2	44,227,946 - 44,282,867 (-)	NCBI

RefSeq Acc Id:

XM_063281724 ⟹ XP_063137794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI

RefSeq Acc Id:

XM_063281725 ⟹ XP_063137795

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI

RefSeq Acc Id:

XM_063281727 ⟹ XP_063137797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI

RefSeq Acc Id:

XM_063281728 ⟹ XP_063137798

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI

RefSeq Acc Id:

XM_063281729 ⟹ XP_063137799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI

RefSeq Acc Id:

XM_063281730 ⟹ XP_063137800

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	45,961,174 - 46,015,960 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001071115	(Get FASTA)	NCBI Sequence Viewer
	XP_038958110	(Get FASTA)	NCBI Sequence Viewer
	XP_038958111	(Get FASTA)	NCBI Sequence Viewer
	XP_038958112	(Get FASTA)	NCBI Sequence Viewer
	XP_038958113	(Get FASTA)	NCBI Sequence Viewer
	XP_038958115	(Get FASTA)	NCBI Sequence Viewer
	XP_038958116	(Get FASTA)	NCBI Sequence Viewer
	XP_063137794	(Get FASTA)	NCBI Sequence Viewer
	XP_063137795	(Get FASTA)	NCBI Sequence Viewer
	XP_063137797	(Get FASTA)	NCBI Sequence Viewer
	XP_063137798	(Get FASTA)	NCBI Sequence Viewer
	XP_063137799	(Get FASTA)	NCBI Sequence Viewer
	XP_063137800	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB33364	(Get FASTA)	NCBI Sequence Viewer
	ACT31323	(Get FASTA)	NCBI Sequence Viewer
	AFD32171	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013035
	ENSRNOP00000083389
GenBank Protein	Q64060	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001071115 ⟸ NM_001077647

- UniProtKB:

Q64060 (UniProtKB/Swiss-Prot), A0A8I5ZVB9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGDEDWEAEILKPHVSSYVPVFEKDKYSSGANGDTFNRTSASSSEMEDGPSGRDHFMRSGFSSG
RNLGNRDIGESSKRETTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESTNDCEDTQTRSRG
FSKRGGYPDGNDSEASGPFRRGGRDSEYDQDQGSQRGGGLFGSRKPAASDSGSGDTFQSRSGNA
RGAYKGLNEEVVTGSGKNSWKSEAEGGESSDIQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKY
DTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTG
SGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVI
YGGTQFGHSIRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKL
ISCPGMPSKEQRQTLLFSATFPEEIQRLAGEFLKSNYLFVAVGQVGGACRDVQQSILQVGPVFK
KRKLVEILRNIGDERPMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKC
PVLVATSVAARGLDIENVQHVINFNLPSTIDEYVHRIGRTGRCGNTGRAISFFDTESDNHLAQP
LVKVLSDAQQDVPAWLEEIAFSSYAPPSFSNSTRGAVFASFDTRKNFQGKNTLNTAGISSAQAP
NPVDDESWD

hide sequence

Ensembl Acc Id:

ENSRNOP00000013035 ⟸ ENSRNOT00000013035

RefSeq Acc Id:	XP_038958116 ⟸ XM_039102188
- Peptide Label:	isoform X11
- UniProtKB:	Q64060 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038958113 ⟸ XM_039102185
- Peptide Label:	isoform X8
- UniProtKB:	Q64060 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038958110 ⟸ XM_039102182
- Peptide Label:	isoform X3
- UniProtKB:	C7E3F3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958115 ⟸ XM_039102187
- Peptide Label:	isoform X9
- UniProtKB:	Q64060 (UniProtKB/Swiss-Prot), A0A8I5ZVB9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958112 ⟸ XM_039102184
- Peptide Label:	isoform X4
- UniProtKB:	H9BFH0 (UniProtKB/TrEMBL), C7E3F3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958111 ⟸ XM_039102183
- Peptide Label:	isoform X3
- UniProtKB:	C7E3F3 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085415 ⟸ ENSRNOT00000108725

Ensembl Acc Id:

ENSRNOP00000083389 ⟸ ENSRNOT00000117202

RefSeq Acc Id:	XP_063137800 ⟸ XM_063281730
- Peptide Label:	isoform X10
- UniProtKB:	Q64060 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063137799 ⟸ XM_063281729
- Peptide Label:	isoform X7
- UniProtKB:	Q64060 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063137797 ⟸ XM_063281727
- Peptide Label:	isoform X5
- UniProtKB:	Q64060 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063137798 ⟸ XM_063281728
- Peptide Label:	isoform X6
- UniProtKB:	C7E3F3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063137795 ⟸ XM_063281725
- Peptide Label:	isoform X2
- UniProtKB:	C7E3F3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063137794 ⟸ XM_063281724
- Peptide Label:	isoform X1
- UniProtKB:	C7E3F3 (UniProtKB/TrEMBL)

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64060-F1-model_v2	AlphaFold	Q64060	1-713	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691135

Promoter ID:

EPDNEW_R1660

Type:

initiation region

Name:

Ddx4_1

Description:

DEAD-box helicase 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	44,504,226 - 44,504,286	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308793	AgrOrtholog
BioCyc Gene	G2FUF-54393	BioCyc
Ensembl Genes	ENSRNOG00000026686	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000013035	ENTREZGENE
	ENSRNOT00000117202	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot
	Helicase_ATP-bd	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	RNA-helicase_DEAD-box_CS	UniProtKB/Swiss-Prot
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:310090	UniProtKB/Swiss-Prot
NCBI Gene	310090	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE DBP3	UniProtKB/Swiss-Prot
Pfam	DEAD	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
PhenoGen	Ddx4	PhenoGen
PROSITE	DEAD_ATP_HELICASE	UniProtKB/Swiss-Prot
	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot
	HELICASE_CTER	UniProtKB/Swiss-Prot
	Q_MOTIF	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000026686	RatGTEx
SMART	DEXDc	UniProtKB/Swiss-Prot
	HELICc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZVB9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A3A6_RAT	UniProtKB/TrEMBL
	C7E3F3	ENTREZGENE, UniProtKB/TrEMBL
	DDX4_RAT	UniProtKB/Swiss-Prot
	F1LQD1_RAT	UniProtKB/TrEMBL
	H9BFH0	ENTREZGENE, UniProtKB/TrEMBL
	Q64060	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Ddx4	DEAD-box helicase 4	Ddx4	DEAD (Asp-Glu-Ala-Asp) box polypeptide 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ddx4	DEAD (Asp-Glu-Ala-Asp) box polypeptide 4	Ddx4_predicted	DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ddx4_predicted	DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar