Advanced Search (OLGA)

Gene: Fzr1 (fizzy and cell division cycle 20 related 1) Rattus norvegicus

Analyze

Symbol:

Fzr1

Name:

fizzy and cell division cycle 20 related 1

RGD ID:

1308713

Description:

Predicted to enable anaphase-promoting complex binding activity; ubiquitin ligase activator activity; and ubiquitin-like ligase-substrate adaptor activity. Predicted to be involved in several processes, including anaphase-promoting complex-dependent catabolic process; negative regulation of cell cycle process; and negative regulation of cellular senescence. Predicted to act upstream of or within several processes, including lens fiber cell differentiation; nucleobase-containing compound biosynthetic process; and regulation of meiotic nuclear division. Predicted to be located in nucleus. Predicted to be part of anaphase-promoting complex. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 109. Orthologous to human FZR1 (fizzy and cell division cycle 20 related 1); PARTICIPATES IN cell cycle pathway, mitotic; ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Cdh1; fizzy-related protein homolog; fizzy/cell division cycle 20 related 1; fizzy/cell division cycle 20 related 1 (Drosophila); LOC314642

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FZR1 (fizzy and cell division cycle 20 related 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fzr1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fzr1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FZR1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FZR1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fzr1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FZR1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FZR1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fzr1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fzr1 (fizzy and cell division cycle 20 related 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FZR1 (fizzy and cell division cycle 20 related 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fzr1 (fizzy and cell division cycle 20 related 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fzr1b (fizzy/cell division cycle 20 related 1b)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	fzr1a (fizzy/cell division cycle 20 related 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fzr1a (fizzy/cell division cycle 20 related 1a)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDH1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDH1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	fzr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fzr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fzr1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	8,982,765 - 8,994,689 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	8,989,769 - 8,995,199 (+)	Ensembl				GRCr8
mRatBN7.2	7	8,332,029 - 8,343,953 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,332,029 - 8,343,952 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	11,217,693 - 11,229,531 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,093,180 - 13,105,018 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	10,960,829 - 10,972,679 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,201,690 - 11,213,614 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,201,690 - 11,213,613 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	11,368,581 - 11,380,505 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	9,816,491 - 9,829,006 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	6,521,094 - 6,533,016 (+)	NCBI		Celera
RGSC_v3.1	7	9,816,497 - 9,829,003 (+)	NCBI
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

developmental and epileptic encephalopathy 109 (ISO)

Developmental Disabilities (ISO)

genetic disease (ISO)

Polyploidy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

alpha-pinene (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

diazinon (EXP,ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dieldrin (EXP)

elemental selenium (ISO)

epoxiconazole (ISO)

fenvalerate (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

hydrogen cyanide (ISO)

lactacystin (ISO)

methimazole (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

nickel dichloride (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

potassium cyanide (ISO)

progesterone (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anaphase-promoting complex-dependent catabolic process (IBA,IEA,ISO)

cell division (IEA)

lens fiber cell differentiation (ISO)

mitotic G2 DNA damage checkpoint signaling (IEA,ISO)

negative regulation of cellular senescence (IEA,ISO)

negative regulation of meiotic cell cycle process involved in oocyte maturation (ISO)

positive regulation of anaphase-promoting complex-dependent catabolic process (IBA)

positive regulation of cell population proliferation (IEA,ISO)

positive regulation of ubiquitin protein ligase activity (ISO)

proteolysis involved in protein catabolic process (ISO)

regulation of meiotic nuclear division (ISO)

Cellular Component

anaphase-promoting complex (IBA)

nuclear membrane (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

anaphase-promoting complex binding (IBA,IEA)

protein binding (IPI,ISO)

ubiquitin ligase activator activity (IBA)

ubiquitin-like ligase-substrate adaptor activity (IEA,ISO)

ubiquitin-protein transferase activator activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Cdk5 phosphorylates Cdh1 and modulates cyclin B1 stability in excitotoxicity.	Maestre C, etal., EMBO J. 2008 Oct 22;27(20):2736-45. doi: 10.1038/emboj.2008.195. Epub 2008 Sep 25.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11459825	PMID:11459826	PMID:12477932	PMID:14716021	PMID:17190794	PMID:17215516	PMID:18662541	PMID:18753608	PMID:19448625	PMID:21241890	PMID:21596315	PMID:21982804
PMID:26364211	PMID:27514492	PMID:30460429	PMID:31785347

Genomics

Comparative Map Data

Fzr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	8,982,765 - 8,994,689 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	8,989,769 - 8,995,199 (+)	Ensembl				GRCr8
mRatBN7.2	7	8,332,029 - 8,343,953 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,332,029 - 8,343,952 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	11,217,693 - 11,229,531 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,093,180 - 13,105,018 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	10,960,829 - 10,972,679 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,201,690 - 11,213,614 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,201,690 - 11,213,613 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	11,368,581 - 11,380,505 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	9,816,491 - 9,829,006 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	6,521,094 - 6,533,016 (+)	NCBI		Celera
RGSC_v3.1	7	9,816,497 - 9,829,003 (+)	NCBI
Cytogenetic Map	7	q11	NCBI

FZR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	3,506,311 - 3,538,334 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	3,506,277 - 3,538,334 (+)	Ensembl			hg38	GRCh38
GRCh37	19	3,506,309 - 3,538,332 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	3,473,954 - 3,489,325 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	3,473,953 - 3,489,325	NCBI
Celera	19	3,443,104 - 3,473,565 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	3,272,276 - 3,302,307 (+)	NCBI		HuRef
CHM1_1	19	3,505,941 - 3,536,425 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	3,484,482 - 3,516,505 (+)	NCBI		T2T-CHM13v2.0

Fzr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	81,202,713 - 81,214,204 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	81,202,056 - 81,214,350 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	81,366,879 - 81,378,370 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	81,366,222 - 81,378,516 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	80,829,624 - 80,841,115 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	80,770,008 - 80,781,499 (-)	NCBI		MGSCv36	mm8
Celera	10	82,387,912 - 82,399,403 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Fzr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	5,481,916 - 5,505,521 (+)	Ensembl
ChiLan1.0	NW_004955495	5,481,914 - 5,503,690 (+)	NCBI	ChiLan1.0	ChiLan1.0

FZR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	7,905,039 - 7,933,998 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	7,136,645 - 7,165,610 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	2,533,172 - 2,564,301 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	3,483,601 - 3,512,798 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	3,500,117 - 3,510,867 (+)	Ensembl			panPan2	panpan1.1

FZR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	55,866,893 - 55,877,077 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	55,869,693 - 55,876,936 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	55,591,521 - 55,613,508 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	56,526,317 - 56,548,298 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	56,527,357 - 56,548,191 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	55,581,995 - 55,603,964 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	56,065,400 - 56,087,328 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	56,264,144 - 56,286,128 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fzr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	215,827,214 - 215,833,762 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	1,993,721 - 2,009,240 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	2,000,872 - 2,007,569 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FZR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	75,121,835 - 75,146,835 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	75,122,599 - 75,164,134 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	75,783,163 - 75,789,212 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FZR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	3,272,247 - 3,300,370 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	3,288,407 - 3,298,464 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666081	5,191,962 - 5,219,993 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fzr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	6,236,842 - 6,256,679 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624828	6,236,861 - 6,254,763 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fzr1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	153,513,081 - 153,525,664 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fzr1
48 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	56
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000005624
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1669658	46669658	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	1	23748937	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	7216097	52216097	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	1	31777942	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1709527	46709527	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	32612984	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	29716167	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34650782	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	32612984	Rat

Markers in Region

AW108046

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	8,343,937 - 8,344,048 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	11,213,599 - 11,213,709	NCBI	Rnor6.0
Rnor_5.0	7	11,380,490 - 11,380,600	UniSTS	Rnor5.0
RGSC_v3.4	7	9,828,477 - 9,828,587	UniSTS	RGSC3.4
Celera	7	6,533,001 - 6,533,111	UniSTS
Cytogenetic Map	7	q11	UniSTS

RH136691

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC162059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005624 ⟹ ENSRNOP00000005624

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	8,989,769 - 8,995,199 (+)	Ensembl
mRatBN7.2 Ensembl	7	8,332,029 - 8,343,952 (+)	Ensembl
Rnor_6.0 Ensembl	7	11,201,690 - 11,213,613 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113516 ⟹ ENSRNOP00000083932

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	8,989,769 - 8,995,199 (+)	Ensembl
mRatBN7.2 Ensembl	7	8,332,029 - 8,343,952 (+)	Ensembl

RefSeq Acc Id:

NM_001108074 ⟹ NP_001101544

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	8,982,765 - 8,994,689 (+)	NCBI
mRatBN7.2	7	8,332,029 - 8,343,953 (+)	NCBI
Rnor_6.0	7	11,201,690 - 11,213,614 (+)	NCBI
Rnor_5.0	7	11,368,581 - 11,380,505 (+)	NCBI
RGSC_v3.4	7	9,816,491 - 9,829,006 (+)	RGD
Celera	7	6,521,094 - 6,533,016 (+)	NCBI

Sequence:

show sequence

CGTGAGCGGCGGCGGCGGGGCCTGGCGCAGCGGCGGAGCCTCGAACGGGCGCGGCGTGTTCCTG
AGACTAGCGGGAACCGGCGGGAGCCGGCTGGCGACCGGAGCGAGGCAGGCTACCCTCGCAGGCT
AACCTCGGCTGCGGGCCCCGCCCCGCCTGCCCGCCTGCCATGGACCAGGACTATGAGCGACGGC
TCCTGCGACAGATCATCATCCAAAATGAGAACACCGTGCCGTGTGTCTCAGAGATGCGGAGAAC
CCTGACACCAGCCAACTCCCCAGTGTCCTCTCCCAGCAAGCATGGTGACCGCTTCATCCCCTCG
CGGGCCGGGGCCAACTGGAGCGTAAACTTCCATAGGATCAATGAAAATGAGAAGTCCCCCAGCC
AGAACCGCAAAGCCAAGGATGCCACCTCAGACAACGGCAAAGATGGCCTTGCTTACTCCGCACT
GCTGAAGAATGAGCTGCTGGGTGCCGGCATCGAGAAGGTGCAGGACCCACAGACAGAGGATCGG
CGGCTGCAGCCATCCACCCCAGAGCACAAGGGTCTCTTTACGTATTCCCTCAGCAGCAAGCGCT
CGAGTCCAGATGATGGCAACGACGTGTCCCCATATTCTCTATCCCCAGTTAGCAACAAAAGTCA
GAAGCTGCTGCGGTCGCCTCGGAAGCCCACGCGCAAGATTTCCAAGATTCCCTTCAAGGTGCTG
GACGCGCCAGAGCTTCAGGACGACTTCTACCTCAACCTGGTGGACTGGTCCTCCCTCAATGTGC
TCAGCGTGGGGCTAGGCACCTGCGTGTACCTGTGGAGCGCATGCACCAGCCAGGTGACCCGGCT
CTGTGACCTCTCCGTAGAAGGGGACTCAGTGACTTCCGTGGGCTGGTCTGAGCGGGGGAACCTG
GTGGCAGTCGGCACACATAAGGGCTTCGTGCAGATCTGGGATGCTGCCGCTGGCAAGAAGCTAT
CTGTGCTGGAGGGACACACAGCGCGCGTGGGGGCGCTGGCCTGGAATGCTGACCAGCTGTCATC
CGGTAGCCGGGACCGCATGATCCTGCAACGGGACATCCGCACACCAGCACTGCAGTCAGAGCGG
CGGCTGCAAGGCCATCGACAGGAAGTATGCGGCCTGAAGTGGTCCACAGACCACCAGCTGCTCG
CCTCGGGGGGCAATGACAACAAGCTGCTCGTGTGGAACCACTCAAGTCTAAGCCCTGTGCAGCA
GTACACGGAGCACCTGGCAGCCGTGAAGGCTATTGCCTGGTCACCACACCAGCATGGACTGCTG
GCCTCTGGTGGTGGCACTGCCGACCGCTGCATCCGGTTCTGGAACACTCTGACAGGCCAGCCTC
TGCAGTGCATTGACACAGGCTCACAAGTGTGCAACCTGGCCTGGTCCAAGCATGCCAACGAGCT
GGTGAGCACACATGGCTACTCACAGAACCAGATCCTCGTGTGGAAGTACCCGTCCCTTACACAG
GTGGCCAAGCTCACTGGCCACTCGTATCGTGTCCTCTACCTGGCCATGTCCCCTGACGGGGAGG
CCATCGTCACTGGAGCTGGAGATGAGACCCTTCGGTTCTGGAACGTCTTCAGCAAGACACGCTC
TACAAAGGAATCCGTGTCTGTGCTCAACCTCTTTACCCGGATCCGATAGACCCGCAGGCGGGAT
GCACGGCCCCATGGGCAGAGATGGAGTAGCCAGCATGCATGGGCCCTGCTGTACCTACCGTTCC
CAGACGCATCTGGCGGGCGGGAGTCGGGCCGGAGACCCCAGAGTCTCATTAAATGCCTCATTGG
GAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101544	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62059	(Get FASTA)	NCBI Sequence Viewer
	EDL89153	(Get FASTA)	NCBI Sequence Viewer
	EDL89154	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005624
	ENSRNOP00000005624.6
	ENSRNOP00000083932.1

RefSeq Acc Id:

NP_001101544 ⟸ NM_001108074

- UniProtKB:

B1WCA1 (UniProtKB/TrEMBL), F7EFQ4 (UniProtKB/TrEMBL), A0A8I5ZWS1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDQDYERRLLRQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVNFHRI
NENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEHKGLF
TYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNL
VDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIW
DAAAGKKLSVLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPALQSERRLQGHRQEVCGLK
WSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRF
WNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLY
LAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFTRIR

hide sequence

Ensembl Acc Id:

ENSRNOP00000005624 ⟸ ENSRNOT00000005624

Ensembl Acc Id:

ENSRNOP00000083932 ⟸ ENSRNOT00000113516

Protein Domains

CDC20/Fizzy WD40

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WCA1-F1-model_v2	AlphaFold	B1WCA1	1-493	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694974

Promoter ID:

EPDNEW_R5498

Type:

initiation region

Name:

Fzr1_1

Description:

fizzy and cell division cycle 20 related 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	11,201,638 - 11,201,698	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308713	AgrOrtholog
BioCyc Gene	G2FUF-35022	BioCyc
Ensembl Genes	ENSRNOG00000004169	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005624	ENTREZGENE
	ENSRNOT00000005624.7	UniProtKB/TrEMBL
	ENSRNOT00000113516.2	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7115243	IMAGE-MGC_LOAD
InterPro	Cdc20/Fizzy	UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom	UniProtKB/TrEMBL
	WD40_CDC20-Fz	UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:314642	UniProtKB/TrEMBL
MGC_CLONE	MGC:188054	IMAGE-MGC_LOAD
NCBI Gene	314642	ENTREZGENE
PANTHER	FIZZY-RELATED PROTEIN HOMOLOG	UniProtKB/TrEMBL
	PTHR19918	UniProtKB/TrEMBL
Pfam	WD40_CDC20-Fz	UniProtKB/TrEMBL
PhenoGen	Fzr1	PhenoGen
PROSITE	WD_REPEATS_1	UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/TrEMBL
	WD_REPEATS_REGION	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004169	RatGTEx
SMART	WD40	UniProtKB/TrEMBL
Superfamily-SCOP	WD40_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZWS1	ENTREZGENE, UniProtKB/TrEMBL
	B1WCA1	ENTREZGENE, UniProtKB/TrEMBL
	F7EFQ4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-02-01	Fzr1	fizzy and cell division cycle 20 related 1	Fzr1	fizzy/cell division cycle 20 related 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-06-10	Fzr1	fizzy/cell division cycle 20 related 1	Fzr1	fizzy/cell division cycle 20 related 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Fzr1	fizzy/cell division cycle 20 related 1 (Drosophila)	Fzr1_predicted	fizzy/cell division cycle 20 related 1 (Drosophila) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Fzr1_predicted	fizzy/cell division cycle 20 related 1 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)