Advanced Search (OLGA)

Gene: Celf1 (CUGBP, Elav-like family member 1) Rattus norvegicus

Analyze

Symbol:

Celf1

Name:

CUGBP, Elav-like family member 1

RGD ID:

1307721

Description:

Enables mRNA 3'-UTR binding activity. Involved in cellular response to polyamine macromolecule; negative regulation of epithelial cell proliferation; and post-transcriptional regulation of gene expression. Acts upstream of or within positive regulation of gene expression. Predicted to be located in cytoplasmic stress granule; male germ cell nucleus; and perinucleolar compartment. Predicted to be part of ribonucleoprotein complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human CELF1 (CUGBP Elav-like family member 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

bruno-like protein 2; CELF-1; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG-BP- and ETR-3-like factor 1; CUG-BP1; CUGBP Elav-like family member 1; Cugbp1; LOC362160; RNA-binding protein BRUNOL-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CELF1 (CUGBP Elav-like family member 1)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Celf1 (CUGBP, Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Celf1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CELF1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CELF1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Celf1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CELF1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CELF1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Celf1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Celf1 (CUGBP Elav-like family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FAM170A (family with sequence similarity 170 member A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CELF1 (CUGBP Elav-like family member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Celf1 (CUGBP, Elav-like family member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	celf1 (cugbp, Elav-like family member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	bru1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	bru1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	bru2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	bru2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	etr-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	etr-1	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	celf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,380,407 - 97,455,253 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	97,380,424 - 97,452,791 (+)	Ensembl				GRCr8
mRatBN7.2	3	76,924,591 - 76,999,429 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,924,613 - 76,999,426 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	80,456,901 - 80,474,495 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	89,055,917 - 89,073,511 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,906,772 - 86,924,389 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,768,900 - 79,844,548 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,823,945 - 79,842,082 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	86,477,670 - 86,553,301 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	75,360,927 - 75,378,582 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	76,188,178 - 76,205,831 (+)	NCBI		Celera
RGSC_v3.1	3	75,257,298 - 75,274,950 (+)	NCBI
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

3',5'-cyclic UMP (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

acetohydrazide (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

doxorubicin (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

finasteride (EXP)

folic acid (ISO)

gentamycin (EXP)

hydrazine (ISO)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

methapyrilene (EXP)

methylmercury chloride (ISO)

nitrates (ISO)

Nivalenol (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

poly(I:C) (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (ISO)

quercetin (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamibarotene (ISO)

temozolomide (ISO)

trichloroethene (EXP)

triptonide (ISO)

troglitazone (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to polyamine macromolecule (IEP)

cerebral cortex development (ISO)

cerebral cortex neuron differentiation (ISO)

mRNA destabilization (IDA)

mRNA processing (IEA)

mRNA splice site recognition (IBA,ISO)

negative regulation of cell population proliferation (IDA)

negative regulation of epithelial cell proliferation (IMP)

negative regulation of gene expression (ISO)

negative regulation of translation (ISO)

positive regulation of gene expression (IDA,ISO)

positive regulation of multicellular organism growth (ISO)

post-transcriptional gene silencing (IEA,IMP,ISO)

regulation of alternative mRNA splicing, via spliceosome (IBA,ISO)

regulation of cell cycle (IDA)

regulation of inflammatory response (ISO)

regulation of RNA splicing (ISO,ISS)

RNA splicing (IEA)

spermatid development (ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytoplasmic stress granule (ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

perinucleolar compartment (ISO)

ribonucleoprotein complex (IBA)

Molecular Function

BRE binding (ISO)

lncRNA binding (IEA,ISO)

mRNA 3'-UTR binding (IBA,IDA,IEA,ISO)

mRNA 5'-UTR binding (ISO)

mRNA binding (IEA,ISO)

nucleic acid binding (IEA)

pre-mRNA binding (ISO)

protein binding (ISO)

RNA binding (IEA,ISO,ISS)

translation initiation factor binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	A positive feedback regulation of Heme oxygenase 1 by CELF1 in cardiac myoblast cells.	Liu Y, etal., Biochim Biophys Acta Gene Regul Mech. 2019 Feb;1862(2):209-218. doi: 10.1016/j.bbagrm.2018.11.006. Epub 2018 Nov 30.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Regulation of cyclin-dependent kinase 4 translation through CUG-binding protein 1 and microRNA-222 by polyamines.	Xiao L, etal., Mol Biol Cell. 2011 Sep;22(17):3055-69. doi: 10.1091/mbc.E11-01-0069. Epub 2011 Jul 7.
8.	CELF1/p53 axis: a sustained antiproliferative signal leading to villus atrophy under total parenteral nutrition.	Yan JK, etal., FASEB J. 2019 Mar;33(3):3378-3391. doi: 10.1096/fj.201801695R. Epub 2018 Dec 4.

Additional References at PubMed

PMID:10893231	PMID:11158314	PMID:12477932	PMID:14726956	PMID:15830352	PMID:16754681	PMID:16931514	PMID:16946708	PMID:17130239	PMID:19075228	PMID:19106619	PMID:19946888
PMID:22072795	PMID:22658674	PMID:22681889	PMID:24625528	PMID:26283512	PMID:26366374	PMID:28763438

Genomics

Comparative Map Data

Celf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,380,407 - 97,455,253 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	97,380,424 - 97,452,791 (+)	Ensembl				GRCr8
mRatBN7.2	3	76,924,591 - 76,999,429 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,924,613 - 76,999,426 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	80,456,901 - 80,474,495 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	89,055,917 - 89,073,511 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,906,772 - 86,924,389 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,768,900 - 79,844,548 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,823,945 - 79,842,082 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	86,477,670 - 86,553,301 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	75,360,927 - 75,378,582 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	76,188,178 - 76,205,831 (+)	NCBI		Celera
RGSC_v3.1	3	75,257,298 - 75,274,950 (+)	NCBI
Cytogenetic Map	3	q24	NCBI

CELF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	47,465,937 - 47,565,539 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	47,465,933 - 47,565,569 (-)	Ensembl			hg38	GRCh38
GRCh37	11	47,487,489 - 47,587,091 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	47,446,521 - 47,531,264 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	47,446,521 - 47,472,649	NCBI
Celera	11	47,629,224 - 47,716,566 (-)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	47,187,464 - 47,274,966 (-)	NCBI		HuRef
CHM1_1	11	47,486,759 - 47,574,018 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	47,625,789 - 47,725,965 (-)	NCBI		T2T-CHM13v2.0

Celf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	90,770,604 - 90,849,842 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	90,770,727 - 90,849,842 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	90,940,259 - 91,019,497 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	90,940,382 - 91,019,497 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	90,780,615 - 90,857,212 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	90,741,297 - 90,817,894 (+)	NCBI		MGSCv36	mm8
Celera	2	92,325,145 - 92,401,546 (+)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	50.44	NCBI

Celf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	742,017 - 817,647 (+)	Ensembl
ChiLan1.0	NW_004955422	742,017 - 817,649 (+)	NCBI	ChiLan1.0	ChiLan1.0

CELF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	49,670,341 - 49,769,748 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	49,690,101 - 49,789,615 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	47,415,600 - 47,515,254 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	47,967,831 - 48,054,437 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	47,967,831 - 48,008,487 (-)	Ensembl			panPan2	panpan1.1

CELF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	42,105,316 - 42,199,017 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	42,105,324 - 42,179,161 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	40,836,673 - 40,929,905 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	42,761,777 - 42,855,073 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	42,761,776 - 42,837,373 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	42,248,478 - 42,341,677 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	41,803,324 - 41,896,565 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	42,532,815 - 42,626,091 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Celf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	19,577,453 - 19,673,643 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	1,753,088 - 1,785,310 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	1,699,774 - 1,785,285 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CELF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	15,066,510 - 15,154,386 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	15,066,518 - 15,161,478 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	16,311,078 - 16,328,018 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CELF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	17,764,915 - 17,852,974 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	17,817,422 - 17,853,783 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	115,056,967 - 115,148,559 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Celf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624767	1,263,231 - 1,344,896 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Celf1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	65,116,541 - 65,190,724 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Celf1
299 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	373
Count of miRNA genes:	209
Interacting mature miRNAs:	271
Transcripts:	ENSRNOT00000014484
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

RH133857

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,994,814 - 76,995,028 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,839,933 - 79,840,146	NCBI	Rnor6.0
Rnor_5.0	3	86,548,686 - 86,548,899	UniSTS	Rnor5.0
RGSC_v3.4	3	75,376,429 - 75,376,642	UniSTS	RGSC3.4
Celera	3	76,203,678 - 76,203,891	UniSTS
Cytogenetic Map	3	q24	UniSTS

X61451

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,992,683 - 76,992,799 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,837,802 - 79,837,917	NCBI	Rnor6.0
Rnor_5.0	3	86,546,555 - 86,546,670	UniSTS	Rnor5.0
RGSC_v3.4	3	75,374,298 - 75,374,413	UniSTS	RGSC3.4
Celera	3	76,201,547 - 76,201,662	UniSTS
Cytogenetic Map	3	q24	UniSTS

RH125691

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,994,961 - 76,995,080 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,840,080 - 79,840,198	NCBI	Rnor6.0
Rnor_5.0	3	86,548,833 - 86,548,951	UniSTS	Rnor5.0
RGSC_v3.4	3	75,376,576 - 75,376,694	UniSTS	RGSC3.4
Celera	3	76,203,825 - 76,203,943	UniSTS
Cytogenetic Map	3	q24	UniSTS

AA997594

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,997,557 - 76,997,772 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,842,677 - 79,842,891	NCBI	Rnor6.0
Rnor_5.0	3	86,551,430 - 86,551,644	UniSTS	Rnor5.0
RGSC_v3.4	3	75,379,173 - 75,379,387	UniSTS	RGSC3.4
Celera	3	76,206,422 - 76,206,636	UniSTS
RH 3.4 Map	3	708.5	UniSTS
Cytogenetic Map	3	q24	UniSTS

MARC_11599-11600:1002739035:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	97,439,404 - 97,440,026 (+)	Marker Load Pipeline
mRatBN7.2	3	76,983,581 - 76,984,203 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,828,209 - 79,828,830	NCBI	Rnor6.0
Rnor_5.0	3	86,536,962 - 86,537,583	UniSTS	Rnor5.0
RGSC_v3.4	3	75,365,196 - 75,365,817	UniSTS	RGSC3.4
Celera	3	76,192,445 - 76,193,066	UniSTS
Cytogenetic Map	3	q24	UniSTS

MARC_7541-7542:996687927:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	97,448,558 - 97,449,056 (+)	Marker Load Pipeline
mRatBN7.2	3	76,992,734 - 76,993,233 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,837,853 - 79,838,351	NCBI	Rnor6.0
Rnor_5.0	3	86,546,606 - 86,547,104	UniSTS	Rnor5.0
RGSC_v3.4	3	75,374,349 - 75,374,847	UniSTS	RGSC3.4
Celera	3	76,201,598 - 76,202,096	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434320	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105411	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105412	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014484 ⟹ ENSRNOP00000014484

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	97,380,424 - 97,450,925 (+)	Ensembl
mRatBN7.2 Ensembl	3	76,924,614 - 76,995,102 (+)	Ensembl
Rnor_6.0 Ensembl	3	79,823,945 - 79,842,082 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106910 ⟹ ENSRNOP00000080849

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	97,435,136 - 97,452,791 (+)	Ensembl
mRatBN7.2 Ensembl	3	76,924,613 - 76,999,170 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109347 ⟹ ENSRNOP00000094511

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	97,380,470 - 97,450,925 (+)	Ensembl
mRatBN7.2 Ensembl	3	76,924,625 - 76,999,426 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151133 ⟹ ENSRNOP00000111254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	97,423,106 - 97,450,925 (+)	Ensembl

RefSeq Acc Id:

NM_001025421 ⟹ NP_001020592

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,435,136 - 97,452,791 (+)	NCBI
mRatBN7.2	3	76,979,313 - 76,996,968 (+)	NCBI
Rnor_6.0	3	79,823,945 - 79,842,086 (+)	NCBI
Rnor_5.0	3	86,477,670 - 86,553,301 (+)	NCBI
RGSC_v3.4	3	75,360,927 - 75,378,582 (+)	RGD
Celera	3	76,188,178 - 76,205,831 (+)	RGD

Sequence:

show sequence

CTGAGTGTCAGCTCAAAGAAAATGAACGGCACCCTGGACCACCCAGACCAACCAGATCTTGATG
CTATCAAGATGTTTGTGGGCCAGGTTCCAAGGACCTGGTCGGAGAAAGACTTGAGGGAGCTTTT
TGAGCAGTATGGTGCTGTCTATGAAATCAACATCCTAAGGGATAGGAGCCAAAACCCTCCTCAG
AGCAAAGGGTGCTGTTTTGTTACATTTTACACCCGTAAAGCTGCATTAGAAGCTCAGAATGCTC
TCCACAACATGAAGGTTCTACCTGGGATGCATCACCCTATACAGATGAAACCCGCGGACAGTGA
GAAGAACAACGCTGTGGAAGACAGGAAGCTGTTTATTGGTATGATTTCCAAGAAGTGTACTGAA
AATGACATCCGAGTCATGTTTTCTTCGTTTGGACAGATTGAAGAGTGCCGGATATTGCGGGGAC
CTGATGGCTTGAGCAGAGGTTGTGCATTTGTGACTTTTACAACAAGAACCATGGCACAGACAGC
TATCAAAGCAATGCACCAAGCACAGACCATGGAGGGTTGCTCATCCCCCATGGTGGTAAAGTTT
GCTGACACCCAGAAGGACAAAGAACAGAAGAGAATGGCCCAGCAGCTCCAGCAGCAGATGCAGC
AGATTAGTGCAGCGTCTGTGTGGGGGAACCTGGCTGGTCTGAACACACTTGGGCCCCAGTACTT
AGCACTTTATTTGCAGCTCCTTCAGCAGACTGCCAACTCTGGGAACCTCAACACCCTGAGCAGC
CTCCACCCAATGGGAGGGTTAAATGCAATGCAGCTCCAGAATTTGGCTGCACTGGCTGCTGCAG
CTAGTGCAGCTCAGAATACACCAAGTGGTACCAATGCTCTCACTACATCCAGCAGTCCCCTCAG
CGTACTCACCAGTTCAGCAGGGTCTTCACCGAGCTCCAGCAGCAGTAATTCTGTCAACCCCATA
GCCTCACTTGGAGCGCTGCAAACATTAGCCGGAGCAACAGCTGGCCTCAACGTTGGCTCATTGG
CAGGAATGGCTGCTTTGAATGGAGGTTTGGGCAGCAGTGGCCTTTCCAATGGCACTGGGAGTAC
CATGGAAGCCCTCACCCAGGCGTATTCTGGTATCCAGCAATATGCTGCTGCAGCCCTCCCTACT
CTGTACAACCAGAATCTGTTGACACAGCAGAGTATTGGTGCTGCTGGAAGCCAGAAGGAAGGTC
CAGAAGGAGCCAACCTGTTCATCTATCACCTGCCCCAAGAGTTTGGAGACCAGGACTTACTGCA
GATGTTTATGCCCTTTGGGAATGTCGTGTCTGCCAAGGTTTTCATAGACAAGCAGACCAACCTG
AGCAAGTGTTTTGGTTTTGTAAGTTATGACAATCCTGTCTCAGCTCAAGCTGCCATCCAGTCCA
TGAACGGCTTTCAAATTGGAATGAAGAGGCTTAAAGTGCAGCTCAAACGTTCGAAGAATGATAG
TAAGCCCTACTGATCGTGCTCCCCTCTGAGACTGGAGTGAGAAGATCTTCTGATTCCTGCCGTT
TGTTCATCGTTGTGCCTAAAGCATGTCGATGTGGCGTCAAGTACATCGTCCAAATCCCTGTCTC
TTCAGCTTCTCTGATGCTTGAACTCTCACCTTTGACCTTGTGTTGACCTTTGATGCTGATGTGT
ATTTTATTATGTTTGTTTCTTTCTTTGTTTTTTCTTTTTTCTTTCTTTTTTTTCCCTTTTGTGC
TGCCAAAATTGGTTTTGCTAGAACGACTGCTGAAGGGAAAATATTTAAACTTGCATTTGAATAT
AAAAAAAATCTATTTTTCTAGAACTTCCTAAGATAACCACTTGATTTTGTGATTCCAATTCTTT
GTAACTGTCTCAGAGCAGCCCTACTAGCACATGCCGTGTGGTGTTTGTATCCTTGTGAACACAC
AGCCAGTCCGCTTCCAGGCTTTCTTCCTCTGTGTGCTTCGTTTTAAAGACAGCTTTGAAATAAA
CAATGAAATAAAAGATGTCACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105411 ⟹ XP_038961339

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,440 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,607 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105412 ⟹ XP_038961340

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,394,362 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,606 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105414 ⟹ XP_038961342

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,440 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,607 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105415 ⟹ XP_038961343

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,431 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,609 - 76,999,206 (+)	NCBI

RefSeq Acc Id:

XM_039105416 ⟹ XP_038961344

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,440 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,604 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105417 ⟹ XP_038961345

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,427 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,606 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105419 ⟹ XP_038961347

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,427 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,606 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105420 ⟹ XP_038961348

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,440 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,924,608 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105422 ⟹ XP_038961350

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,430,853 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,975,033 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_039105423 ⟹ XP_038961351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,410,500 - 97,455,253 (+)	NCBI
mRatBN7.2	3	76,954,678 - 76,999,429 (+)	NCBI

RefSeq Acc Id:

XM_063284140 ⟹ XP_063140210

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,407 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284141 ⟹ XP_063140211

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,440 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284142 ⟹ XP_063140212

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,440 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284144 ⟹ XP_063140214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,380,427 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284145 ⟹ XP_063140215

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,423,712 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284146 ⟹ XP_063140216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,392,917 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284147 ⟹ XP_063140217

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,430,857 - 97,455,253 (+)	NCBI

RefSeq Acc Id:

XM_063284149 ⟹ XP_063140219

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,430,850 - 97,455,253 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020592	(Get FASTA)	NCBI Sequence Viewer
	NP_001421245	(Get FASTA)	NCBI Sequence Viewer
	NP_001421246	(Get FASTA)	NCBI Sequence Viewer
	NP_001421247	(Get FASTA)	NCBI Sequence Viewer
	NP_001421248	(Get FASTA)	NCBI Sequence Viewer
	NP_001421249	(Get FASTA)	NCBI Sequence Viewer
	NP_001421250	(Get FASTA)	NCBI Sequence Viewer
	NP_001421251	(Get FASTA)	NCBI Sequence Viewer
	NP_001421252	(Get FASTA)	NCBI Sequence Viewer
	NP_001421253	(Get FASTA)	NCBI Sequence Viewer
	NP_001421254	(Get FASTA)	NCBI Sequence Viewer
	XP_038961339	(Get FASTA)	NCBI Sequence Viewer
	XP_038961340	(Get FASTA)	NCBI Sequence Viewer
	XP_038961342	(Get FASTA)	NCBI Sequence Viewer
	XP_038961343	(Get FASTA)	NCBI Sequence Viewer
	XP_038961344	(Get FASTA)	NCBI Sequence Viewer
	XP_038961345	(Get FASTA)	NCBI Sequence Viewer
	XP_038961347	(Get FASTA)	NCBI Sequence Viewer
	XP_038961348	(Get FASTA)	NCBI Sequence Viewer
	XP_038961350	(Get FASTA)	NCBI Sequence Viewer
	XP_038961351	(Get FASTA)	NCBI Sequence Viewer
	XP_063140210	(Get FASTA)	NCBI Sequence Viewer
	XP_063140211	(Get FASTA)	NCBI Sequence Viewer
	XP_063140212	(Get FASTA)	NCBI Sequence Viewer
	XP_063140214	(Get FASTA)	NCBI Sequence Viewer
	XP_063140215	(Get FASTA)	NCBI Sequence Viewer
	XP_063140216	(Get FASTA)	NCBI Sequence Viewer
	XP_063140217	(Get FASTA)	NCBI Sequence Viewer
	XP_063140219	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98012	(Get FASTA)	NCBI Sequence Viewer
	EDL79496	(Get FASTA)	NCBI Sequence Viewer
	EDL79497	(Get FASTA)	NCBI Sequence Viewer
	EDL79498	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014484
	ENSRNOP00000080849
	ENSRNOP00000094511
	ENSRNOP00000111254
GenBank Protein	Q4QQT3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020592 ⟸ NM_001025421

- UniProtKB:

Q4QQT3 (UniProtKB/Swiss-Prot), A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKGCCFV
TFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMF
SSFGQIEECRILRGPDGLSRGCAFVTFTTRTMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDK
EQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTANSGNLNTLSSLHPMGGL
NAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQ
TLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLL
TQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFV
SYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

hide sequence

Ensembl Acc Id:

ENSRNOP00000014484 ⟸ ENSRNOT00000014484

RefSeq Acc Id:	XP_038961344 ⟸ XM_039105416
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961340 ⟸ XM_039105412
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961345 ⟸ XM_039105417
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961347 ⟸ XM_039105419
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961339 ⟸ XM_039105411
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961342 ⟸ XM_039105414
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038961348 ⟸ XM_039105420
- Peptide Label:	isoform X5
- UniProtKB:	Q4QQT3 (UniProtKB/Swiss-Prot), A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961343 ⟸ XM_039105415
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038961351 ⟸ XM_039105423
- Peptide Label:	isoform X5
- UniProtKB:	Q4QQT3 (UniProtKB/Swiss-Prot), A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038961350 ⟸ XM_039105422
- Peptide Label:	isoform X5
- UniProtKB:	Q4QQT3 (UniProtKB/Swiss-Prot), A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000094511 ⟸ ENSRNOT00000109347

Ensembl Acc Id:

ENSRNOP00000080849 ⟸ ENSRNOT00000106910

RefSeq Acc Id:	XP_063140210 ⟸ XM_063284140
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL), A6HN95 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140214 ⟸ XM_063284144
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063140212 ⟸ XM_063284142
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140211 ⟸ XM_063284141
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063140216 ⟸ XM_063284146
- Peptide Label:	isoform X5
- UniProtKB:	Q4QQT3 (UniProtKB/Swiss-Prot), A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140215 ⟸ XM_063284145
- Peptide Label:	isoform X5
- UniProtKB:	Q4QQT3 (UniProtKB/Swiss-Prot), A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140219 ⟸ XM_063284149
- Peptide Label:	isoform X7
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL), A0A8L2Q6U8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063140217 ⟸ XM_063284147
- Peptide Label:	isoform X6
- UniProtKB:	A0A8I5ZTX3 (UniProtKB/TrEMBL), A0A8I6AL51 (UniProtKB/TrEMBL), A6HN97 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000111254 ⟸ ENSRNOT00000151133

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QQT3-F1-model_v2	AlphaFold	Q4QQT3	1-487	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307721	AgrOrtholog
BioCyc Gene	G2FUF-48755	BioCyc
Ensembl Genes	ENSRNOG00000010379	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000014484	ENTREZGENE
	ENSRNOT00000106910	ENTREZGENE
	ENSRNOT00000109347	ENTREZGENE
	ENSRNOT00000151133	ENTREZGENE
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7454358	IMAGE-MGC_LOAD
InterPro	CELF1/2_RRM1	UniProtKB/Swiss-Prot
	CELF1/2_RRM2	UniProtKB/Swiss-Prot
	CELF1/2_RRM3	UniProtKB/Swiss-Prot
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot
	RBD_domain_sf	UniProtKB/Swiss-Prot
	RRM_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:362160	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116159	IMAGE-MGC_LOAD
NCBI Gene	362160	ENTREZGENE
PANTHER	RNA BINDING PROTEIN	UniProtKB/Swiss-Prot
Pfam	RRM_1	UniProtKB/Swiss-Prot
PhenoGen	Celf1	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010379	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZTX3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AL51	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q6U8	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LK04_RAT	UniProtKB/TrEMBL
	A6HN95	ENTREZGENE, UniProtKB/TrEMBL
	A6HN97	ENTREZGENE, UniProtKB/TrEMBL
	CELF1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Celf1	CUGBP, Elav-like family member 1	Cugbp1	CUG triplet repeat, RNA binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Cugbp1	CUG triplet repeat, RNA binding protein 1	Cugbp1_predicted	CUG triplet repeat, RNA binding protein 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cugbp1_predicted	CUG triplet repeat, RNA binding protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message