Advanced Search (OLGA)

Gene: Mad2l2 (mitotic arrest deficient 2 like 2) Rattus norvegicus

Analyze

Symbol:

Mad2l2

Name:

mitotic arrest deficient 2 like 2

RGD ID:

1307499

Description:

Predicted to enable JUN kinase binding activity; RNA polymerase II-specific DNA-binding transcription factor binding activity; and transcription corepressor activity. Involved in positive regulation of epithelial to mesenchymal transition; positive regulation of extracellular matrix assembly; and positive regulation of gene expression. Predicted to be located in spindle. Predicted to be part of anaphase-promoting complex and zeta DNA polymerase complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Fanconi anemia complementation group V. Orthologous to human MAD2L2 (mitotic arrest deficient 2 like 2); PARTICIPATES IN cell cycle pathway, mitotic; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC313702; MAD2 mitotic arrest deficient-like 2; MAD2 mitotic arrest deficient-like 2 (yeast); MAD2-like protein 2; mitotic arrest deficient 2-like protein 2; mitotic spindle assembly checkpoint protein MAD2B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAD2L2 (mitotic arrest deficient 2 like 2)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mad2l2 (MAD2 mitotic arrest deficient-like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mad2l2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAD2L2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAD2L2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mad2l2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAD2L2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAD2L2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mad2l2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mad2l2 (mitotic arrest deficient 2 like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MGMT (O-6-methylguanine-DNA methyltransferase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MAD2L2 (mitotic arrest deficient 2 like 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mad2l2 (MAD2 mitotic arrest deficient-like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mad2l2 (mitotic arrest deficient 2 like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	rev7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	rev7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mad2l2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	163,846,678 - 163,859,851 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	163,846,687 - 163,859,851 (+)	Ensembl				GRCr8
mRatBN7.2	5	158,563,545 - 158,576,698 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	158,563,567 - 158,576,693 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	161,288,790 - 161,293,471 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	163,110,607 - 163,115,262 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	163,066,954 - 163,071,609 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	164,943,183 - 164,956,255 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	164,950,917 - 164,956,255 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	168,601,233 - 168,614,293 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	165,218,362 - 165,222,828 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	156,851,516 - 156,855,981 (+)	NCBI		Celera
RGSC_v3.1	5	165,228,549 - 165,233,014 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Asthenozoospermia (ISO)

Fanconi anemia complementation group V (ISO)

oligospermia (ISO)

Teratozoospermia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

diquat (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

finasteride (EXP)

flutamide (EXP)

hydroxyurea (ISO)

methyl methanesulfonate (ISO)

N-methyl-N-nitrosourea (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

sodium arsenite (ISO)

Soman (EXP)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (ISO)

cell division (IEA)

DNA damage response (IEA)

DNA damage response, signal transduction resulting in transcription (ISO,ISS)

DNA repair (IBA)

DNA-templated transcription (IEA)

double-strand break repair (ISO,ISS)

error-prone translesion synthesis (ISO)

negative regulation of canonical Wnt signaling pathway (ISO)

negative regulation of cell-cell adhesion mediated by cadherin (ISO)

negative regulation of double-strand break repair via homologous recombination (ISO)

negative regulation of epithelial to mesenchymal transition (ISO)

negative regulation of protein catabolic process (ISO,ISS)

negative regulation of transcription by competitive promoter binding (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

negative regulation of ubiquitin protein ligase activity (ISO,ISS)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of double-strand break repair via nonhomologous end joining (ISO)

positive regulation of epithelial to mesenchymal transition (IMP)

positive regulation of extracellular matrix assembly (IMP)

positive regulation of gene expression (IMP)

positive regulation of isotype switching (ISO)

positive regulation of peptidyl-serine phosphorylation (ISO,ISS)

regulation of cell growth (ISO,ISS)

regulation of epithelial to mesenchymal transition (IEA)

translesion synthesis (ISO)

Cellular Component

anaphase-promoting complex (ISO,ISS)

cytoplasm (IEA)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO,ISS)

site of DNA damage (ISO)

spindle (IEA,ISO,ISS)

zeta DNA polymerase complex (IBA,ISO,ISS)

Molecular Function

JUN kinase binding (ISO,ISS)

protein binding (ISO)

protein-macromolecule adaptor activity (ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (ISO)

transcription corepressor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	MAD2B promotes tubular epithelial-to-mesenchymal transition and renal tubulointerstitial fibrosis via Skp2.	Tang H, etal., J Mol Med (Berl). 2016 Nov;94(11):1297-1307. doi: 10.1007/s00109-016-1448-6. Epub 2016 Aug 3.

Additional References at PubMed

PMID:11459825	PMID:11459826	PMID:12477932	PMID:15988022	PMID:17296730	PMID:17541814	PMID:19443654	PMID:20164194	PMID:21063390	PMID:24444371	PMID:25651564	PMID:27957796
PMID:29656893

Genomics

Comparative Map Data

Mad2l2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	163,846,678 - 163,859,851 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	163,846,687 - 163,859,851 (+)	Ensembl				GRCr8
mRatBN7.2	5	158,563,545 - 158,576,698 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	158,563,567 - 158,576,693 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	161,288,790 - 161,293,471 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	163,110,607 - 163,115,262 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	163,066,954 - 163,071,609 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	164,943,183 - 164,956,255 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	164,950,917 - 164,956,255 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	168,601,233 - 168,614,293 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	165,218,362 - 165,222,828 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	156,851,516 - 156,855,981 (+)	NCBI		Celera
RGSC_v3.1	5	165,228,549 - 165,233,014 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

MAD2L2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	11,674,480 - 11,691,830 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	11,657,230 - 11,692,605 (-)	Ensembl			hg38	GRCh38
GRCh37	1	11,734,537 - 11,751,616 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	11,657,124 - 11,663,780 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	11,668,802 - 11,675,459	NCBI
Celera	1	10,846,601 - 10,863,739 (-)	NCBI		Celera
Cytogenetic Map	1	p36.22	NCBI
HuRef	1	10,888,642 - 10,905,769 (-)	NCBI		HuRef
CHM1_1	1	11,722,539 - 11,739,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	11,218,548 - 11,235,917 (-)	NCBI		T2T-CHM13v2.0

Mad2l2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	148,214,615 - 148,230,161 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	148,214,841 - 148,230,156 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	148,130,158 - 148,145,704 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	148,130,384 - 148,145,699 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	147,514,599 - 147,519,805 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	146,984,290 - 146,989,496 (+)	NCBI		MGSCv36	mm8
Celera	4	150,401,823 - 150,407,027 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	78.67	NCBI

Mad2l2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	2,191,903 - 2,198,538 (+)	Ensembl
ChiLan1.0	NW_004955486	2,191,903 - 2,197,193 (+)	NCBI	ChiLan1.0	ChiLan1.0

MAD2L2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	216,532,737 - 216,550,231 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	215,178,858 - 215,196,364 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	10,436,532 - 10,454,023 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	11,654,963 - 11,671,364 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	11,654,963 - 11,661,526 (-)	Ensembl			panPan2	panpan1.1

MAD2L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	84,539,724 - 84,549,402 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	84,545,226 - 84,549,356 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	81,076,962 - 81,081,699 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	85,207,730 - 85,212,516 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	85,201,068 - 85,212,508 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	81,956,536 - 81,961,266 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	82,957,166 - 82,961,884 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	84,020,037 - 84,024,757 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mad2l2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	34,713,906 - 34,718,120 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	538,625 - 542,901 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	538,703 - 542,901 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAD2L2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	71,773,154 - 71,786,517 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	71,773,680 - 71,779,192 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	65,692,635 - 65,698,160 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAD2L2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	120,099,928 - 120,115,954 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	120,110,269 - 120,116,083 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	23,977,591 - 23,984,254 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mad2l2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	1,282,082 - 1,286,997 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624818	1,274,553 - 1,286,750 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mad2l2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	12,635,583 - 12,648,863 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mad2l2
48 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	109
Count of miRNA genes:	56
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000012193, ENSRNOT00000055658
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	160111176	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	156396728	172190305	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	160071170	172129029	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	156396728	167181764	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	156289283	171137955	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat

Markers in Region

RH132073

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	163,859,350 - 163,859,651 (+)	Marker Load Pipeline
mRatBN7.2	5	158,576,197 - 158,576,498 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	164,955,755 - 164,956,055	NCBI	Rnor6.0
Rnor_5.0	5	168,613,793 - 168,614,093	UniSTS	Rnor5.0
RGSC_v3.4	5	165,222,328 - 165,222,628	UniSTS	RGSC3.4
Celera	5	156,855,481 - 156,855,781	UniSTS
RH 3.4 Map	5	1107.5	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH133258

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	158,576,936 - 158,577,117 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	164,956,494 - 164,956,674	NCBI	Rnor6.0
Rnor_5.0	5	168,614,532 - 168,614,712	UniSTS	Rnor5.0
RGSC_v3.4	5	165,223,067 - 165,223,247	UniSTS	RGSC3.4
Celera	5	156,856,220 - 156,856,400	UniSTS
RH 3.4 Map	5	1104.4	UniSTS
Cytogenetic Map	5	q36	UniSTS

Mad2l2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	158,572,165 - 158,572,310 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	164,951,723 - 164,951,867	NCBI	Rnor6.0
Rnor_5.0	5	168,609,761 - 168,609,905	UniSTS	Rnor5.0
Celera	5	156,851,450 - 156,851,594	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001394241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287825	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287827	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012193 ⟹ ENSRNOP00000012193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	164,951,874 - 164,956,248 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000055658 ⟹ ENSRNOP00000052521

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	163,846,687 - 163,859,834 (+)	Ensembl
mRatBN7.2 Ensembl	5	158,563,567 - 158,576,677 (+)	Ensembl
Rnor_6.0 Ensembl	5	164,951,789 - 164,956,255 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076305 ⟹ ENSRNOP00000068004

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	164,951,768 - 164,954,766 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083678 ⟹ ENSRNOP00000070808

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	163,846,687 - 163,859,834 (+)	Ensembl
mRatBN7.2 Ensembl	5	158,563,576 - 158,576,693 (+)	Ensembl
Rnor_6.0 Ensembl	5	164,950,917 - 164,956,147 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000123467 ⟹ ENSRNOP00000107271

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	163,855,170 - 163,859,851 (+)	Ensembl

RefSeq Acc Id:

NM_001012106 ⟹ NP_001012106

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,855,170 - 163,859,851 (+)	NCBI
mRatBN7.2	5	158,572,017 - 158,576,698 (+)	NCBI
Rnor_6.0	5	164,951,789 - 164,956,255 (+)	NCBI
Rnor_5.0	5	168,601,233 - 168,614,293 (+)	NCBI
RGSC_v3.4	5	165,218,362 - 165,222,828 (+)	RGD
Celera	5	156,851,516 - 156,855,981 (+)	RGD

Sequence:

show sequence

CCCGCGTGCCCGGCTGGGTGCTGTGAGTCCCTACAAACACCCTTCGCGCCCTCCCCCAGGCAGC
CAAGGATGACCACCCTCACGCGCCAAGACCTCAACTTCGGCCAAGTGGTGGCCGACGTGCTCTC
CGAGTTCCTGGAGGTGGCCGTGCACTTGATCCTCTATGTGCGCGAGGTCTACCCGGTGGGCATC
TTTCAGAAGCGCAAGAAGTACAACGTGCCGGTTCAGATGTCCTGCCACCCAGAGCTGAACCAGT
ACATCCAGGACACACTTCACTGCGTCAAACCACTCCTGGAGAAGAACGATGTGGAGAAGGTGGT
GGTGGTGATTTTGGATAAGGAACACCGCCCAGTGGAGAAGTTTGTCTTTGAGATCACTCAGCCA
CCCTTGCTGTCCATCAAGCTAGGTGGCCTCAAACAGACCGTTTCTCTAACTGTCTTGGGGTCCT
GGAGGTATGCAGACTTGAGCGGTACCCTGGGTGTCCTCTCGACAGCTGAATATTTGAGTGACCT
AAAGGGACCTTTGTACCCTACCTCTATTCAGTCAGTTCAGACTCCCTCCTGTCTCATGTGGAGC
AGCTGCTTCGAGCCTTCATTCTTAAGATTAGTGTGTGTGACGCTGTCCTCGACCATAATCCTCC
AGGCTGCACGTTTACAGTTCTCGTGCACACAAGAGAAGCTGCCACTCGGAACATGGAGAAGATA
CAGGTCATCAAGGACTTCCCCTGGATCCTGGCAGATGAGCAAGATGTCCACATGCATGATCCCC
GGTTGATACCCCTGAAAACCATGACTTCGGACATTTTAAAGATGCAACTTTACGTAGAAGAGCG
AGCTCATAAAAACAGCTGAGGGCACCTCTGTCACCAGACGCCCAGCCATCCCACTCTGGGACCC
AGGCCCAGGACAGTACTGCAGGGCCCCAGACTCCAAGTGCTCTTATTGCCTTGACGTGTGGCCG
TCCCTCCGGTCAGGCTGCTCAGCCCTGCTTGCCTTCGTGAGGCAGCCTTCCCGGGAGCCGAGGG
AAGGATCCCAGGACAGACGGCCATTTCTCAGCGGCCTCCAGGGCTCAGCTCACACTGTCCACCT
GAAATACTGTGCCGTGTGTTATCGTTAATAAAGTGGCCCCGAGGGCTGACCGCATTGTCGTTAA
CCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

NM_001394241 ⟹ NP_001381170

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,855,170 - 163,859,851 (+)	NCBI
mRatBN7.2	5	158,572,017 - 158,576,698 (+)	NCBI

RefSeq Acc Id:

XM_039110095 ⟹ XP_038966023

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,846,678 - 163,859,831 (+)	NCBI
mRatBN7.2	5	158,563,545 - 158,576,693 (+)	NCBI

RefSeq Acc Id:

XM_063287824 ⟹ XP_063143894

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,846,719 - 163,859,403 (+)	NCBI

RefSeq Acc Id:

XM_063287825 ⟹ XP_063143895

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,846,719 - 163,859,403 (+)	NCBI

RefSeq Acc Id:

XM_063287826 ⟹ XP_063143896

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,850,103 - 163,859,403 (+)	NCBI

RefSeq Acc Id:

XM_063287827 ⟹ XP_063143897

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,852,660 - 163,859,403 (+)	NCBI

RefSeq Acc Id:

XM_063287828 ⟹ XP_063143898

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,846,719 - 163,859,831 (+)	NCBI

RefSeq Acc Id:

XM_063287829 ⟹ XP_063143899

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,852,639 - 163,859,831 (+)	NCBI

RefSeq Acc Id:

XM_063287830 ⟹ XP_063143900

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,850,296 - 163,859,831 (+)	NCBI

RefSeq Acc Id:

XM_063287831 ⟹ XP_063143901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,850,077 - 163,859,831 (+)	NCBI

RefSeq Acc Id:

XM_063287832 ⟹ XP_063143902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	163,855,573 - 163,859,403 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001012106	(Get FASTA)	NCBI Sequence Viewer
	NP_001381170	(Get FASTA)	NCBI Sequence Viewer
	XP_038966023	(Get FASTA)	NCBI Sequence Viewer
	XP_063143894	(Get FASTA)	NCBI Sequence Viewer
	XP_063143895	(Get FASTA)	NCBI Sequence Viewer
	XP_063143896	(Get FASTA)	NCBI Sequence Viewer
	XP_063143897	(Get FASTA)	NCBI Sequence Viewer
	XP_063143898	(Get FASTA)	NCBI Sequence Viewer
	XP_063143899	(Get FASTA)	NCBI Sequence Viewer
	XP_063143900	(Get FASTA)	NCBI Sequence Viewer
	XP_063143901	(Get FASTA)	NCBI Sequence Viewer
	XP_063143902	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87687	(Get FASTA)	NCBI Sequence Viewer
	D3Z8D9	(Get FASTA)	NCBI Sequence Viewer
	EDL81101	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000052521.1
	ENSRNOP00000070808
	ENSRNOP00000070808.1
	ENSRNOP00000107271

RefSeq Acc Id:	NP_001012106 ⟸ NM_001012106
- Peptide Label:	isoform 2
- UniProtKB:	D3Z8D9 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYI QDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSIKLGGLKQTVSLTVLGSWR YADLSGTLGVLSTAEYLSDLKGPLYPTSIQSVQTPSCLMWSSCFEPSFLRLVCVTLSSTIILQA ARLQFSCTQEKLPLGTWRRYRSSRTSPGSWQMSKMSTCMIPG hide sequence

Ensembl Acc Id:

ENSRNOP00000052521 ⟸ ENSRNOT00000055658

Ensembl Acc Id:

ENSRNOP00000012193 ⟸ ENSRNOT00000012193

Ensembl Acc Id:

ENSRNOP00000070808 ⟸ ENSRNOT00000083678

Ensembl Acc Id:

ENSRNOP00000068004 ⟸ ENSRNOT00000076305

RefSeq Acc Id:	XP_038966023 ⟸ XM_039110095
- Peptide Label:	isoform X2
- UniProtKB:	D3Z8D9 (UniProtKB/Swiss-Prot), Q5PPH8 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	NP_001381170 ⟸ NM_001394241
- Peptide Label:	isoform 1
- UniProtKB:	D3Z8D9 (UniProtKB/Swiss-Prot), Q5PPH8 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063143898 ⟸ XM_063287828
- Peptide Label:	isoform X2
- UniProtKB:	Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063143894 ⟸ XM_063287824
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063143895 ⟸ XM_063287825
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063143901 ⟸ XM_063287831
- Peptide Label:	isoform X2
- UniProtKB:	Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063143896 ⟸ XM_063287826
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063143900 ⟸ XM_063287830
- Peptide Label:	isoform X2
- UniProtKB:	Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063143899 ⟸ XM_063287829
- Peptide Label:	isoform X2
- UniProtKB:	Q5PPH8 (UniProtKB/Swiss-Prot), D3Z8D9 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063143897 ⟸ XM_063287827
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063143902 ⟸ XM_063287832
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000107271 ⟸ ENSRNOT00000123467

Protein Domains

HORMA

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3Z8D9-F1-model_v2	AlphaFold	D3Z8D9	1-211	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694264

Promoter ID:

EPDNEW_R4782

Type:

multiple initiation site

Name:

Mad2l2_1

Description:

mitotic arrest deficient 2 like 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	164,951,770 - 164,951,830	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307499	AgrOrtholog
BioCyc Gene	G2FUF-39175	BioCyc
Ensembl Genes	ENSRNOG00000009134	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000055658.5	UniProtKB/Swiss-Prot
	ENSRNOT00000083678	ENTREZGENE
	ENSRNOT00000083678.2	UniProtKB/Swiss-Prot
	ENSRNOT00000123467	ENTREZGENE
Gene3D-CATH	3.30.900.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7307981	IMAGE-MGC_LOAD
InterPro	HORMA_dom	UniProtKB/Swiss-Prot
	HORMA_dom_sf	UniProtKB/Swiss-Prot
	Mad2-like	UniProtKB/Swiss-Prot
KEGG Report	rno:313702	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105558	IMAGE-MGC_LOAD
NCBI Gene	313702	ENTREZGENE
PANTHER	MITOTIC SPINDLE ASSEMBLY CHECKPOINT PROTEIN MAD2B	UniProtKB/Swiss-Prot
	PTHR11842	UniProtKB/Swiss-Prot
Pfam	HORMA	UniProtKB/Swiss-Prot
PhenoGen	Mad2l2	PhenoGen
PROSITE	HORMA	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009134	RatGTEx
Superfamily-SCOP	SSF56019	UniProtKB/Swiss-Prot
UniProt	D3Z8D9	ENTREZGENE, UniProtKB/Swiss-Prot
	Q5PPH8	ENTREZGENE
UniProt Secondary	Q5PPH8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Mad2l2	mitotic arrest deficient 2 like 2	Mad2l2	MAD2 mitotic arrest deficient-like 2 (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Mad2l2	MAD2 mitotic arrest deficient-like 2 (yeast)	Mad2l2_predicted	MAD2 mitotic arrest deficient-like 2 (yeast) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mad2l2_predicted	MAD2 mitotic arrest deficient-like 2 (yeast) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)