Advanced Search (OLGA)

Gene: Nmnat2 (nicotinamide nucleotide adenylyltransferase 2) Rattus norvegicus

Analyze

Symbol:

Nmnat2

Name:

nicotinamide nucleotide adenylyltransferase 2

RGD ID:

1307331

Description:

Predicted to enable nicotinamide-nucleotide adenylyltransferase activity; nicotinate-nucleotide adenylyltransferase activity; and protein ADP-ribosyltransferase-substrate adaptor activity. Involved in NAD+ biosynthetic process and cellular response to angiotensin. Predicted to be located in cytoplasmic vesicle; synapse; and trans-Golgi network. Predicted to be extrinsic component of membrane. Predicted to be active in Golgi apparatus and cytosol. Biomarker of hypertrophic cardiomyopathy. Orthologous to human NMNAT2 (nicotinamide nucleotide adenylyltransferase 2); PARTICIPATES IN de novo nicotinamide adenine dinucleotide biosynthetic pathway; niacin metabolic pathway; nicotinamide adenine dinucleotide biosynthesis, the salvage pathway; INTERACTS WITH 6-propyl-2-thiouracil; atrazine; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC289095; naMN adenylyltransferase 1; naMN adenylyltransferase 2; nicotinamide mononucleotide adenylyltransferase 2; nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2; nicotinate-nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 2; NMN adenylyltransferase 2; NMN/NaMN adenylyltransferase 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NMNAT2 (nicotinamide nucleotide adenylyltransferase 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nmnat2 (nicotinamide nucleotide adenylyltransferase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NMA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	NMA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Drosophila melanogaster (fruit fly):	Nmnat	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	nmat-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	nmat-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	nmat-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	NMA2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	NMA2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nmnat2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	67,655,794 - 67,831,609 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	67,655,807 - 67,831,608 (+)	Ensembl				GRCr8
mRatBN7.2	13	65,105,950 - 65,277,350 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	65,105,950 - 65,278,484 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	67,707,031 - 67,881,048 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	68,994,601 - 69,169,031 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	66,245,587 - 66,420,355 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	70,379,346 - 70,559,311 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	70,379,346 - 70,559,458 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	75,346,746 - 75,525,374 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	67,969,507 - 68,142,926 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	65,010,279 - 65,182,390 (+)	NCBI		Celera
RGSC_v3.1	13	68,067,854 - 68,144,266 (+)	NCBI
Cytogenetic Map	13	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hypertrophic cardiomyopathy (IEP)

vascular dementia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-methylcholine (ISO)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

dibutyl phthalate (EXP)

dimethylarsinic acid (EXP)

dorsomorphin (ISO)

doxorubicin (EXP)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

glyphosate (EXP)

L-methionine (ISO)

maneb (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

N-nitrosodiethylamine (ISO)

ozone (ISO)

panobinostat (ISO)

paraquat (ISO)

PCB138 (ISO)

pentanal (ISO)

piperonyl butoxide (ISO)

propanal (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (EXP)

sotorasib (ISO)

sunitinib (ISO)

testosterone (ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vorinostat (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' NAD+ biosynthetic process from L-tryptophan (ISO)

cellular response to angiotensin (IEP)

NAD+ biosynthetic process (IEA,IMP)

NAD+ biosynthetic process via the salvage pathway (IBA,ISO)

NADP+ biosynthetic process (ISO)

negative regulation of cytoplasmic translation (IEA,ISO)

nucleotide biosynthetic process (IEA)

pyridine nucleotide biosynthetic process (IEA)

Cellular Component

axon (IEA)

cytoplasm (IEA)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

cytosol (IEA,ISO)

extrinsic component of membrane (ISO)

Golgi apparatus (IBA,IEA,ISO)

Golgi membrane (IEA)

late endosome (ISO)

synapse (ISO)

trans-Golgi network (ISO)

transport vesicle (ISO)

Molecular Function

adenylyltransferase activity (IEA)

ATP binding (IEA)

catalytic activity (IEA)

nicotinamide-nucleotide adenylyltransferase activity (IBA,IEA,ISO)

nicotinate-nucleotide adenylyltransferase activity (IBA,IEA,ISO)

nucleotide binding (IEA)

nucleotidyltransferase activity (IEA)

protein ADP-ribosyltransferase-substrate adaptor activity (IEA,ISO,ISS)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

de novo nicotinamide adenine dinucleotide biosynthetic pathway (ISO)

monoterpenoid biosynthetic pathway (IEA)

niacin metabolic pathway (IEA,ISO)

nicotinamide adenine dinucleotide biosynthesis, the salvage pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Nmnat2 protects cardiomyocytes from hypertrophy via activation of SIRT6.	Cai Y, etal., FEBS Lett. 2012 Mar 23;586(6):866-74. doi: 10.1016/j.febslet.2012.02.014. Epub 2012 Feb 20.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	The secret life of NAD+: an old metabolite controlling new metabolic signaling pathways.	Houtkooper RH, etal., Endocr Rev. 2010 Apr;31(2):194-223. doi: 10.1210/er.2009-0026. Epub 2009 Dec 9.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12359228	PMID:16118205	PMID:17402747	PMID:20943658	PMID:37208728

Genomics

Comparative Map Data

Nmnat2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	67,655,794 - 67,831,609 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	67,655,807 - 67,831,608 (+)	Ensembl				GRCr8
mRatBN7.2	13	65,105,950 - 65,277,350 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	65,105,950 - 65,278,484 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	67,707,031 - 67,881,048 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	68,994,601 - 69,169,031 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	66,245,587 - 66,420,355 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	70,379,346 - 70,559,311 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	70,379,346 - 70,559,458 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	75,346,746 - 75,525,374 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	67,969,507 - 68,142,926 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	65,010,279 - 65,182,390 (+)	NCBI		Celera
RGSC_v3.1	13	68,067,854 - 68,144,266 (+)	NCBI
Cytogenetic Map	13	q21	NCBI

NMNAT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	183,248,237 - 183,418,380 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	183,248,237 - 183,418,380 (-)	Ensembl			hg38	GRCh38
GRCh37	1	183,217,372 - 183,387,515 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	181,484,002 - 181,654,360 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	179,949,035 - 180,005,666	NCBI
Celera	1	156,328,478 - 156,498,831 (-)	NCBI		Celera
Cytogenetic Map	1	q25.3	NCBI
HuRef	1	154,453,206 - 154,623,670 (-)	NCBI		HuRef
CHM1_1	1	184,640,483 - 184,810,661 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	182,607,574 - 182,777,689 (-)	NCBI		T2T-CHM13v2.0

Nmnat2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	152,830,532 - 152,995,012 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	152,830,744 - 152,995,007 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	152,954,781 - 153,119,266 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	152,954,993 - 153,119,261 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	154,802,231 - 154,966,391 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	154,717,319 - 154,881,479 (+)	NCBI		MGSCv36	mm8
Celera	1	155,375,719 - 155,540,588 (+)	NCBI		Celera
Cytogenetic Map	1	G3	NCBI
cM Map	1	65.15	NCBI

Nmnat2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	22,076,343 - 22,227,200 (-)	Ensembl
ChiLan1.0	NW_004955406	22,077,247 - 22,274,668 (-)	NCBI	ChiLan1.0	ChiLan1.0

NMNAT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	66,299,343 - 66,481,720 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	65,982,821 - 66,162,542 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	158,768,949 - 158,948,711 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	162,927,610 - 163,105,750 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	162,929,609 - 163,105,524 (-)	Ensembl			panPan2	panpan1.1

NMNAT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	16,626,213 - 16,819,681 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	16,631,116 - 16,805,457 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	16,210,918 - 16,405,676 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	16,356,899 - 16,552,072 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	16,359,939 - 16,551,872 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	16,265,302 - 16,460,952 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	16,374,579 - 16,569,799 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	16,505,552 - 16,700,669 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nmnat2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	88,596,542 - 88,739,041 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	6,443,240 - 6,582,026 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	6,443,286 - 6,585,784 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NMNAT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	124,498,109 - 124,696,194 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	124,495,464 - 124,697,911 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	136,809,812 - 136,959,638 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NMNAT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	45,954,934 - 46,130,106 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	45,954,862 - 46,125,378 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	47,172,546 - 47,347,868 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nmnat2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624814	10,293,074 - 10,466,691 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624814	10,288,746 - 10,470,476 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nmnat2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	32,420,367 - 32,594,489 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nmnat2
1181 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	38
Interacting mature miRNAs:	40
Transcripts:	ENSRNOT00000038183
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

D13Rat61

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	67,721,020 - 67,721,227 (+)	Marker Load Pipeline
mRatBN7.2	13	65,170,476 - 65,170,683 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	70,444,874 - 70,445,080	NCBI	Rnor6.0
Rnor_5.0	13	75,412,274 - 75,412,480	UniSTS	Rnor5.0
RGSC_v3.4	13	68,034,721 - 68,034,927	UniSTS	RGSC3.4
RGSC_v3.4	13	68,034,720 - 68,034,927	RGD	RGSC3.4
Celera	13	65,075,471 - 65,075,677	UniSTS
RGSC_v3.1	13	68,048,800 - 68,049,007	RGD
SHRSP x BN Map	13	23.8399	RGD
SHRSP x BN Map	13	23.8399	UniSTS
FHH x ACI Map	13	24.93	RGD
Cytogenetic Map	13	q21	UniSTS

D13Rat196

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	67,780,897 - 67,781,119 (+)	Marker Load Pipeline
mRatBN7.2	13	65,230,360 - 65,230,582 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	70,504,875 - 70,505,096	NCBI	Rnor6.0
Rnor_5.0	13	75,472,190 - 75,472,411	UniSTS	Rnor5.0
RGSC_v3.4	13	68,095,298 - 68,095,519	UniSTS	RGSC3.4
RGSC_v3.4	13	68,095,297 - 68,095,519	RGD	RGSC3.4
Celera	13	65,135,581 - 65,135,802	UniSTS
RGSC_v3.1	13	68,109,281 - 68,109,971	RGD
SHRSP x BN Map	13	23.7598	RGD
SHRSP x BN Map	13	23.7598	UniSTS
FHH x ACI Map	13	24.93	RGD
Cytogenetic Map	13	q21	UniSTS

BE101794

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	65,179,018 - 65,179,171 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	70,453,415 - 70,453,567	NCBI	Rnor6.0
Rnor_5.0	13	75,420,815 - 75,420,967	UniSTS	Rnor5.0
RGSC_v3.4	13	68,043,262 - 68,043,414	UniSTS	RGSC3.4
Celera	13	65,084,018 - 65,084,170	UniSTS
RH 3.4 Map	13	303.4	UniSTS
Cytogenetic Map	13	q21	UniSTS

RH139296

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	13	67,749,459 - 67,749,593 (+)	Marker Load Pipeline
mRatBN7.2	13	65,198,920 - 65,199,054 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	70,473,291 - 70,473,424	NCBI	Rnor6.0
Rnor_5.0	13	75,440,658 - 75,440,791	UniSTS	Rnor5.0
RGSC_v3.4	13	68,063,225 - 68,063,358	UniSTS	RGSC3.4
Celera	13	65,103,868 - 65,104,001	UniSTS
RH 3.4 Map	13	301.5	UniSTS
Cytogenetic Map	13	q21	UniSTS

BF388095

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	65,132,125 - 65,132,305 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	70,405,626 - 70,405,805	NCBI	Rnor6.0
Rnor_5.0	13	75,373,026 - 75,373,205	UniSTS	Rnor5.0
RGSC_v3.4	13	67,995,683 - 67,995,862	UniSTS	RGSC3.4
Celera	13	65,036,451 - 65,036,630	UniSTS
RH 3.4 Map	13	303.0	UniSTS
Cytogenetic Map	13	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	11	67	142	61	60	30	32	30	6	239	131	9	121	61	92	30	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001048042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010056909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	DQ022370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000038183 ⟹ ENSRNOP00000029020

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	67,655,807 - 67,827,889 (+)	Ensembl
mRatBN7.2 Ensembl	13	65,105,950 - 65,277,350 (+)	Ensembl
Rnor_6.0 Ensembl	13	70,379,346 - 70,559,291 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092315

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	67,778,054 - 67,827,889 (+)	Ensembl
mRatBN7.2 Ensembl	13	65,105,950 - 65,264,601 (+)	Ensembl
Rnor_6.0 Ensembl	13	70,524,881 - 70,546,511 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092661 ⟹ ENSRNOP00000075801

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	67,721,309 - 67,827,889 (+)	Ensembl
mRatBN7.2 Ensembl	13	65,105,950 - 65,275,073 (+)	Ensembl
Rnor_6.0 Ensembl	13	70,379,360 - 70,559,458 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099558 ⟹ ENSRNOP00000094422

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	67,655,808 - 67,831,608 (+)	Ensembl
mRatBN7.2 Ensembl	13	65,105,975 - 65,278,484 (+)	Ensembl

RefSeq Acc Id:

NM_001048042 ⟹ NP_001041507

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	67,655,807 - 67,827,889 (+)	NCBI
mRatBN7.2	13	65,105,950 - 65,277,350 (+)	NCBI
Rnor_6.0	13	70,379,346 - 70,559,291 (+)	NCBI
Rnor_5.0	13	75,346,746 - 75,525,374 (+)	NCBI
RGSC_v3.4	13	67,969,507 - 68,142,926 (+)	RGD
Celera	13	65,010,279 - 65,182,390 (+)	RGD

Sequence:

show sequence

GCGTCTAGAGCGGCTCCTTGGAGTCCACAGCATCCACCGCCGGAGCCTCGCCTTCCTTTCTCCG
TCTGCAGACATATCGAGACACAAAAAGAGGAAACCCCTGGATCCGTGCGAGGGACCTATTCCCA
ATATGACCGAGACCACAAAGACCCACGTTATCCTGCTGGCCTGCGGCAGCTTCAATCCCATCAC
TAAAGGGCACATTCAGATGTTCGAAAGAGCCAGGGATTATCTGCACAAGACTGGAAGATTTATT
GTGATTGGTGGTATTGTCTCTCCAGTCCACGACTCCTATGGAAAACAGGGTCTTGTGTCAAGTC
GGCACCGTCTCATCATGTGTCAGCTGGCTGTCCAAAATTCTGACTGGATCAGGGTGGACCCATG
GGAGTGCTACCAGGACACCTGGCAGACAACCTGCAGTGTGTTAGAGCACCATCGAGACCTCATG
AAGAGGGTGACCGGCTGCATCCTCTCCAACGTCAACACGCCTTCCATGACACCTGTGATTGGAC
AGCCACAACACGAGAACACCCAGCCCATTTACCAGAACAGCAATGTGCCCACCAAGCCCACTGC
AGCCAAGATCTTGGGAAAGGTGGGAGAGAGCCTCGGCCGGATCTGCTGTGTCCGTCCACCCGTG
GAGCGCTTCACTTTTGTAGATGAGAACGCCAACCTGGGCACAGTGATGCGGTATGAGGAGATCG
AGCTGCGCATCTTGCTGCTGTGCGGTAGTGACCTGCTGGAGTCCTTCTGCATCCCAGGACTCTG
GAATGAGGCAGATATGGAAGTGATTGTTGGGGATTTTGGGATTGTGGTGGTGCCCCGGGATGCA
GCGGACGCAGACCGAATCATGAATCACTCCTCAATACTCCGCAAATACAAAAACAACATCATGG
TAGTGAAGGATGACATCAACCATCCCATGTCTGTAGTCAGCTCCACCAAAAGCAGGCTGGCCCT
GCAGCATGGGGATGGCCACGTTGTGGATTACCTGTCCCAGCCGGTCATCGACTACATCCTCAAG
AGTCAGCTGTACATCAATGCCTCGGGCTAGCAGATACCCAGCTTTCTGCTCTACTCTCCCCTTG
TCCTCTGCCAACATACTGGCCCCCTCCAGTCACTGTCAGACCCCGGTTTCTCTCCTGCCTCTCT
GTTTCTCTGTGTTCATCTTGACTGTTCTCCCCACTGGCTGACTTAACCCCCACAGTGTGGAGGG
CCTGCGAAGAACCGTGAACCGTG

hide sequence

RefSeq Acc Id:

XM_063272101 ⟹ XP_063128171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	67,791,377 - 67,831,609 (+)	NCBI

RefSeq Acc Id:

XR_010056909

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	67,655,794 - 67,831,609 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001041507	(Get FASTA)	NCBI Sequence Viewer
	XP_063128171	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAY87457	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029020
GenBank Protein	Q0HA29	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001041507 ⟸ NM_001048042

- UniProtKB:

Q0HA29 (UniProtKB/Swiss-Prot), F1LPZ7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSR
HRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQ
PQHENTQPIYQNSNVPTKPTAAKILGKVGESLGRICCVRPPVERFTFVDENANLGTVMRYEEIE
LRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADADRIMNHSSILRKYKNNIMV
VKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG

hide sequence

Ensembl Acc Id:

ENSRNOP00000075801 ⟸ ENSRNOT00000092661

Ensembl Acc Id:

ENSRNOP00000029020 ⟸ ENSRNOT00000038183

Ensembl Acc Id:

ENSRNOP00000094422 ⟸ ENSRNOT00000099558

RefSeq Acc Id:	XP_063128171 ⟸ XM_063272101
- Peptide Label:	isoform X1
- UniProtKB:	F1LPZ7 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q0HA29-F1-model_v2	AlphaFold	Q0HA29	1-307	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698900

Promoter ID:

EPDNEW_R9418

Type:

initiation region

Name:

Nmnat2_1

Description:

nicotinamide nucleotide adenylyltransferase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	70,379,362 - 70,379,422	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307331	AgrOrtholog
BioCyc Gene	G2FUF-17893	BioCyc
BioCyc Pathway	PWY-5653 [NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde]	BioCyc
	PWY3O-4107 [NAD salvage pathway V (PNC V cycle)]	BioCyc
BioCyc Pathway Image	PWY-5653	BioCyc
	PWY3O-4107	BioCyc
Ensembl Genes	ENSRNOG00000027697	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000038183	ENTREZGENE
	ENSRNOT00000099558	ENTREZGENE
Gene3D-CATH	3.40.50.620	UniProtKB/Swiss-Prot
InterPro	Cyt_trans-like	UniProtKB/Swiss-Prot
	Euk_NMN_adenylyltrnsfrase	UniProtKB/Swiss-Prot
	NMNAT_euk	UniProtKB/Swiss-Prot
	Rossmann-like_a/b/a_fold	UniProtKB/Swiss-Prot
KEGG Report	rno:289095	UniProtKB/Swiss-Prot
NCBI Gene	289095	ENTREZGENE
PANTHER	NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE	UniProtKB/Swiss-Prot
	NICOTINAMIDE/NICOTINIC ACID MONONUCLEOTIDE ADENYLYLTRANSFERASE 2	UniProtKB/Swiss-Prot
Pfam	CTP_transf_like	UniProtKB/Swiss-Prot
PhenoGen	Nmnat2	PhenoGen
RatGTEx	ENSRNOG00000027697	RatGTEx
Superfamily-SCOP	Nucleotidylyl transferase	UniProtKB/Swiss-Prot
UniProt	A0A0U1RRT0_RAT	UniProtKB/TrEMBL
	A0A8I6ALK8_RAT	UniProtKB/TrEMBL
	A0A8I6AV98_RAT	UniProtKB/TrEMBL
	F1LPZ7	ENTREZGENE, UniProtKB/TrEMBL
	NMNA2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Nmnat2	nicotinamide nucleotide adenylyltransferase 2	Nmnat2_predicted	nicotinamide nucleotide adenylyltransferase 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Nmnat2_predicted	nicotinamide nucleotide adenylyltransferase 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways