Advanced Search (OLGA)

Gene: Cpa2 (carboxypeptidase A2) Rattus norvegicus

Analyze

Symbol:

Cpa2 (Ensembl: Cpa4)

Name:

carboxypeptidase A2 (Ensembl:carboxypeptidase A4)

RGD ID:

1305563

Description:

Predicted to enable metallocarboxypeptidase activity and zinc ion binding activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human CPA2 (carboxypeptidase A2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

carboxypeptidase A isoform; carboxypeptidase A2 (mapped); carboxypeptidase A2 (pancreatic); CPA2(S); Cpa2_mapped; LOC296959

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CPA2 (carboxypeptidase A2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cpa2 (carboxypeptidase A2, pancreatic)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cpa2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CPA2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CPA2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cpa2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CPA2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CPA2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cpa2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cpa2 (carboxypeptidase A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LINC02491 (long intergenic non-protein coding RNA 2491)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CPA2 (carboxypeptidase A2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cpa2 (carboxypeptidase A2, pancreatic)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpa4 (carboxypeptidase A4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpa4 (carboxypeptidase A4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	cpa2 (carboxypeptidase A2 (pancreatic))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12374	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4408	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG7025	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ECM14	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ECM14	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T06A4.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T06A4.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18585	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4017	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14820	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17633	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17633	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2915	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG18417	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Drosophila melanogaster (fruit fly):	CG32379	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Caenorhabditis elegans (roundworm):	Y18H1A.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T06A4.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZC434.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	suro-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,125,297 - 60,151,066 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	60,118,682 - 60,183,448 (+)	Ensembl				GRCr8
mRatBN7.2	4	59,160,357 - 59,183,677 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,160,357 - 59,183,674 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	64,138,256 - 64,161,826 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	60,054,438 - 60,078,012 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,456,358 - 58,479,936 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	57,855,416 - 57,879,239 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	57,855,416 - 57,879,239 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	57,611,439 - 57,640,155 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	57,452,111 - 57,475,357 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	54,259,278 - 54,282,148 (+)	NCBI		Celera
RGSC_v3.1	4	57,728,244 - 57,751,439 (+)	NCBI
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hypoxia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

Aroclor 1254 (EXP)

atrazine (EXP)

benzo[a]pyrene (EXP)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

cobalt dichloride (EXP)

crocidolite asbestos (ISO)

dibutyl phthalate (EXP)

ethanol (EXP)

lead diacetate (ISO)

methapyrilene (ISO)

paracetamol (EXP)

PCB138 (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

streptozocin (ISO)

tetrachloromethane (EXP)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteolysis (IBA,IEA)

Cellular Component

extracellular region (IEA,ISO)

extracellular space (IBA)

Molecular Function

carboxypeptidase activity (IEA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

metallocarboxypeptidase activity (IBA,IEA,ISO,ISS)

metallopeptidase activity (IEA)

peptidase activity (IEA)

protein binding (IPI)

zinc ion binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structural characterization of the rat carboxypeptidase A1 and B genes. Comparative analysis of the rat carboxypeptidase gene family.	Clauser E, etal., J Biol Chem 1988 Nov 25;263(33):17837-45.
2.	A novel rat carboxypeptidase, CPA2: characterization, molecular cloning, and evolutionary implications on substrate specificity in the carboxypeptidase gene family.	Gardell SJ, etal., J Biol Chem 1988 Nov 25;263(33):17828-36.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	Carboxypeptidase A isoforms produced by distinct genes or alternative splicing in brain and other extrapancreatic tissues.	Normant E, etal., J Biol Chem 1995 Sep 1;270(35):20543-9.
7.	Procarboxypeptidase in rat pancreas. Overall characterization and comparison of the activation processes.	Oppezzo O, etal., Eur J Biochem. 1994 May 15;222(1):55-63.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1761558	PMID:2920728	PMID:22178042

Genomics

Comparative Map Data

Cpa2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	60,125,297 - 60,151,066 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	60,118,682 - 60,183,448 (+)	Ensembl				GRCr8
mRatBN7.2	4	59,160,357 - 59,183,677 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	59,160,357 - 59,183,674 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	64,138,256 - 64,161,826 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	60,054,438 - 60,078,012 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	58,456,358 - 58,479,936 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	57,855,416 - 57,879,239 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	57,855,416 - 57,879,239 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	57,611,439 - 57,640,155 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	57,452,111 - 57,475,357 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	54,259,278 - 54,282,148 (+)	NCBI		Celera
RGSC_v3.1	4	57,728,244 - 57,751,439 (+)	NCBI
Cytogenetic Map	4	q22	NCBI

CPA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	130,266,863 - 130,289,798 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	130,266,863 - 130,289,798 (+)	Ensembl			hg38	GRCh38
GRCh37	7	129,906,703 - 129,929,638 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	129,693,960 - 129,716,871 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	129,500,674 - 129,523,586	NCBI
Celera	7	124,702,462 - 124,725,405 (+)	NCBI		Celera
Cytogenetic Map	7	q32.2	NCBI
HuRef	7	124,269,090 - 124,292,037 (+)	NCBI		HuRef
CHM1_1	7	129,840,284 - 129,863,099 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	131,580,250 - 131,603,180 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	129,292,077 - 129,315,021 (+)	NCBI

Cpa2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	30,541,641 - 30,564,475 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	30,541,581 - 30,564,475 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	30,541,642 - 30,564,476 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	30,541,582 - 30,564,476 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	30,491,642 - 30,514,473 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	30,491,652 - 30,514,483 (+)	NCBI		MGSCv36	mm8
Celera	6	30,551,527 - 30,574,335 (+)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	12.52	NCBI

Cpa2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	10,908,770 - 10,937,755 (+)	Ensembl
ChiLan1.0	NW_004955479	10,909,466 - 10,937,720 (+)	NCBI	ChiLan1.0	ChiLan1.0

CPA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	167,087,823 - 167,112,259 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	19,098,067 - 19,122,503 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	122,203,510 - 122,256,180 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	134,750,878 - 134,773,437 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	134,750,878 - 134,773,437 (+)	Ensembl			panPan2	panpan1.1

CPA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	6,645,142 - 6,665,716 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	6,562,768 - 6,665,659 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	6,331,119 - 6,351,720 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	6,405,439 - 6,426,044 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	6,405,439 - 6,425,966 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	6,610,939 - 6,631,530 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	6,355,610 - 6,376,204 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	6,499,246 - 6,519,841 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cpa2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	24,843,608 - 24,881,073 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936579	4,976,205 - 4,995,719 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936579	4,976,205 - 4,995,719 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	18,557,518 - 18,577,682 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	18,557,518 - 18,581,957 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	19,545,756 - 19,577,295 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	98,896,973 - 98,920,794 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	98,898,373 - 98,920,795 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	4,483,074 - 4,505,757 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpa2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	6,001,929 - 6,024,389 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624783	6,001,911 - 6,024,389 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cpa2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	108,997,115 - 109,019,995 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cpa2
109 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	79
Count of miRNA genes:	67
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000029608
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	40490442	75726188	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	58079875	82597589	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58080146	80212111	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	37269577	82269577	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	40471453	75939996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58079875	92690793	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	59603319	80216952	Rat

Markers in Region

D4Wox41

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	59,170,176 - 59,170,307 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	57,865,234 - 57,865,364	NCBI	Rnor6.0
Rnor_5.0	4	57,626,761 - 57,626,891	UniSTS	Rnor5.0
RGSC_v3.4	4	57,461,929 - 57,462,059	UniSTS	RGSC3.4
Celera	4	54,269,080 - 54,269,210	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	12	64	160	91	90	59	75	59	6	321	167	7	143	73	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH002149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF249031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF249075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF249156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF249511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S79837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000029608 ⟹ ENSRNOP00000038495

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,160,357 - 59,183,674 (+)	Ensembl
Rnor_6.0 Ensembl	4	57,855,416 - 57,879,239 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120200 ⟹ ENSRNOP00000087337

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	59,162,873 - 59,183,674 (+)	Ensembl

RefSeq Acc Id:

NM_001013083 ⟹ NP_001013101

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,127,753 - 60,151,065 (+)	NCBI
mRatBN7.2	4	59,160,357 - 59,183,674 (+)	NCBI
Rnor_6.0	4	57,855,416 - 57,879,239 (+)	NCBI
Rnor_5.0	4	57,611,439 - 57,640,155 (+)	NCBI
RGSC_v3.4	4	57,452,111 - 57,475,357 (+)	RGD
Celera	4	54,259,278 - 54,282,148 (+)	RGD

Sequence:

show sequence

GACCATGAGGTTGACCCTGTTATTGGCTGCCCTACTTGGGTATATCTACTGTCAAGAAACGTTT
GTGGGAGATCAAGTTCTTGAGATCATCCCAAGTCATGAAGAGCAAATTAGAACTCTGCTGCAAT
TGGAGGCTGAAGAGCATCTCGAGCTTGATTTTTGGAAATCACCCACCATCCCTGGGGAGACAGT
CCACGTTCGAGTCCCTTTTGCTAGCATCCAGGCTGTCAAGGTTTTCTTGGAGTCCCAGGGGATC
GATTATTCCATCATGATCGAAGATGTTCAAGTTCTGTTGGATCAAGAGCGGGAAGAAATGCTAT
TCAACCAGCAAAGAGAGCGTGGTGGGAACTTCAACTTTGAGGCCTACCATACCCTGGAAGAGAT
TTACCAAGAAATGGATAACCTCGTGGCTGAGAACCCCGGTCTAGTGAGCAAAGTGAATATCGGT
TCATCTTTTGAAAATCGGCCCATGAATGTGCTCAAGTTCAGCACCGGAGGAGACAAGCCAGCCA
TCTGGCTTGATGCGGGGATCCATGCTCGAGAGTGGGTTACACAAGCTACTGCACTGTGGACAGC
AAACAAGATTGCTTCTGATTATGGAACTGATCCAGCCATCACGTCTCTTCTTAATACTCTGGAT
ATCTTCCTGCTGCCTGTCACCAATCCCGATGGATATGTGTTCTCCCAAACCACCAATCGAATGT
GGAGAAAGACCCGTTCTAAAAGGTCAGGAAGCGGCTGTGTCGGTGTGGATCCTAATCGGAACTG
GGATGCAAATTTCGGAGGACCTGGAGCCAGTAGCAGCCCTTGCTCTGACTCATACCACGGACCC
AAGCCCAACTCTGAAGTTGAAGTGAAATCCATAGTGGACTTCATCAAGAGCCACGGGAAAGTCA
AAGCTTTTATTACCCTTCACAGCTATTCCCAACTGCTTATGTTCCCCTATGGCTATAAATGTAC
CAAGCCAGATGACTTTAATGAGCTGGATGAAGTGGCCCAGAAGGCTGCCCAGGCTTTGAAAAGA
CTGCACGGCACCAGTTATAAAGTGGGACCCATCTGTTCTGTCATCTACCAGGCGAGTGGTGGAA
GCATCGACTGGGCTTACGACCTTGGCATCAAATACTCATTTGCCTTTGAACTGAGGGACACAGG
TTTCTATGGCTTCCTCCTGCCAGCCAAGCAGATCTTGCCGACAGCAGAAGAGACCTGGCTTGGC
CTGAAGACCATCATGGAGCACGTACGAGACCACCCCTATTAGGGATCGGCAGAATAGACCGACA
CCATTAAAGTCTCTGTGGTCTAAAGC

hide sequence

RefSeq Acc Id:

XM_039107280 ⟹ XP_038963208

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,133,035 - 60,151,066 (+)	NCBI
mRatBN7.2	4	59,165,637 - 59,183,677 (+)	NCBI

RefSeq Acc Id:

XM_063285740 ⟹ XP_063141810

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,125,297 - 60,151,066 (+)	NCBI

RefSeq Acc Id:

XM_063285741 ⟹ XP_063141811

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,125,297 - 60,151,066 (+)	NCBI

RefSeq Acc Id:

XM_063285742 ⟹ XP_063141812

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	60,132,918 - 60,151,066 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013101	(Get FASTA)	NCBI Sequence Viewer
	XP_038963208	(Get FASTA)	NCBI Sequence Viewer
	XP_063141810	(Get FASTA)	NCBI Sequence Viewer
	XP_063141811	(Get FASTA)	NCBI Sequence Viewer
	XP_063141812	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40956	(Get FASTA)	NCBI Sequence Viewer
	AAP32037	(Get FASTA)	NCBI Sequence Viewer
	EDM15254	(Get FASTA)	NCBI Sequence Viewer
	EDM15255	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038495
GenBank Protein	P19222	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013101 ⟸ NM_001013083
- Peptide Label:	precursor
- UniProtKB:	Q6LD54 (UniProtKB/Swiss-Prot), P19222 (UniProtKB/Swiss-Prot), G3V976 (UniProtKB/TrEMBL), A6IEG7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLTLLLAALLGYIYCQETFVGDQVLEIIPSHEEQIRTLLQLEAEEHLELDFWKSPTIPGETVH VRVPFASIQAVKVFLESQGIDYSIMIEDVQVLLDQEREEMLFNQQRERGGNFNFEAYHTLEEIY QEMDNLVAENPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTAN KIASDYGTDPAITSLLNTLDIFLLPVTNPDGYVFSQTTNRMWRKTRSKRSGSGCVGVDPNRNWD ANFGGPGASSSPCSDSYHGPKPNSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTK PDDFNELDEVAQKAAQALKRLHGTSYKVGPICSVIYQASGGSIDWAYDLGIKYSFAFELRDTGF YGFLLPAKQILPTAEETWLGLKTIMEHVRDHPY hide sequence

Ensembl Acc Id:

ENSRNOP00000038495 ⟸ ENSRNOT00000029608

RefSeq Acc Id:	XP_038963208 ⟸ XM_039107280
- Peptide Label:	isoform X3
- UniProtKB:	A6IEG8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000087337 ⟸ ENSRNOT00000120200

RefSeq Acc Id:	XP_063141810 ⟸ XM_063285740
- Peptide Label:	isoform X1
- UniProtKB:	Q6LD54 (UniProtKB/Swiss-Prot), P19222 (UniProtKB/Swiss-Prot), A6IEG7 (UniProtKB/TrEMBL), G3V976 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063141811 ⟸ XM_063285741
- Peptide Label:	isoform X1
- UniProtKB:	Q6LD54 (UniProtKB/Swiss-Prot), P19222 (UniProtKB/Swiss-Prot), A6IEG7 (UniProtKB/TrEMBL), G3V976 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063141812 ⟸ XM_063285742
- Peptide Label:	isoform X2
- UniProtKB:	A6IEG8 (UniProtKB/TrEMBL)

Protein Domains

Peptidase M14

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P19222-F1-model_v2	AlphaFold	P19222	1-417	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692936

Promoter ID:

EPDNEW_R3461

Type:

multiple initiation site

Name:

Cpa2_1

Description:

carboxypeptidase A2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	57,855,399 - 57,855,459	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305563	AgrOrtholog
BioCyc Gene	G2FUF-45350	BioCyc
Ensembl Genes	ENSRNOG00000010463	Ensembl, ENTREZGENE
	ENSRNOG00000028092	Ensembl
Ensembl Transcript	ENSRNOT00000029608	ENTREZGENE
Gene3D-CATH	3.30.70.340	UniProtKB/Swiss-Prot
	Zn peptidases	UniProtKB/Swiss-Prot
InterPro	CPA_M14_CPD	UniProtKB/Swiss-Prot
	M14A-like_propep	UniProtKB/Swiss-Prot
	M14A_act_pep	UniProtKB/Swiss-Prot
	Peptidase_M14	UniProtKB/Swiss-Prot
NCBI Gene	296959	ENTREZGENE
PANTHER	CARBOXYPEPTIDASE A2	UniProtKB/Swiss-Prot
	PROTEASE FAMILY M14 CARBOXYPEPTIDASE A,B	UniProtKB/Swiss-Prot
Pfam	Peptidase_M14	UniProtKB/Swiss-Prot
	Propep_M14	UniProtKB/Swiss-Prot
PhenoGen	Cpa2	PhenoGen
PRINTS	CRBOXYPTASEA	UniProtKB/Swiss-Prot
PROSITE	CARBOXYPEPT_ZN_1	UniProtKB/Swiss-Prot
	CARBOXYPEPT_ZN_2	UniProtKB/Swiss-Prot
	PEPTIDASE_M14	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010463	RatGTEx
	ENSRNOG00000028092	RatGTEx
SMART	Zn_pept	UniProtKB/Swiss-Prot
Superfamily-SCOP	Protease propeptides/inhibitors	UniProtKB/Swiss-Prot
	Zn-dependent exopeptidases	UniProtKB/Swiss-Prot
UniProt	A0A8I6GF15_RAT	UniProtKB/TrEMBL
	A0ABK0M088_RAT	UniProtKB/TrEMBL
	A6IEG7	ENTREZGENE, UniProtKB/TrEMBL
	A6IEG8	ENTREZGENE, UniProtKB/TrEMBL
	CBPA2_RAT	UniProtKB/Swiss-Prot
	G3V976	ENTREZGENE, UniProtKB/TrEMBL
	P19222	ENTREZGENE
	Q6LD54	ENTREZGENE
UniProt Secondary	Q6LD54	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Cpa2	carboxypeptidase A2	Cpa2	carboxypeptidase A2 (pancreatic)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Cpa2	carboxypeptidase A2 (pancreatic)	Cpa2_predicted	carboxypeptidase A2 (pancreatic) (predicted)	'predicted' is removed	2292626	APPROVED
2007-04-10	Cpa2_predicted	carboxypeptidase A2 (pancreatic) (predicted)	Cpa2_mapped	carboxypeptidase A2 (mapped)	Data merged from RGD:2389	737654	APPROVED
2005-11-17	Cpa2_mapped	carboxypeptidase A2 (mapped)	Cpa2	carboxypeptidase A2	Symbol and Name updated	1556543	APPROVED
2005-01-12	Cpa2_predicted	carboxypeptidase A2 (pancreatic) (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-11-06	Cpa2	carboxypeptidase A2		Carboxypeptidase A2 (pancreatic)	Name updated	625702	APPROVED
2002-06-10	Cpa2	Carboxypeptidase A2 (pancreatic)			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD