Symbol:
Lsm1
Name:
LSM1 homolog, mRNA degradation associated
RGD ID:
1304967
Description:
Enables mRNA binding activity and pre-mRNA binding activity. Predicted to be involved in deadenylation-dependent decapping of nuclear-transcribed mRNA and histone mRNA catabolic process. Predicted to act upstream of or within negative regulation of neuron differentiation and stem cell population maintenance. Located in axon; dendrite; and neuronal cell body. Part of ribonucleoprotein complex. Orthologous to human LSM1 (LSM1 homolog, mRNA degradation associated); PARTICIPATES IN RNA degradation pathway; INTERACTS WITH 2,4-dinitrotoluene; bisphenol A; fipronil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC364624; LSM1 homolog, U6 small nuclear RNA associated; LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae); LSM1 mRNA degradation associated; LSM1, U6 small nuclear RNA associated; U6 snRNA-associated Sm-like protein LSm1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LSM1 (LSM1 homolog, mRNA degradation associated) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Lsm1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lsm1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LSM1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LSM1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lsm1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LSM1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LSM1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lsm1 (LSM1 homolog, mRNA degradation associated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
LSM1 (LSM1 homolog, mRNA degradation associated)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lsm1 (LSM1 homolog, mRNA degradation associated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lsm1 (LSM1, U6 small nuclear RNA associated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
LSM1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
LSm1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lsm-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lsm1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 72,980,075 - 72,991,581 (-) NCBI GRCr8 mRatBN7.2 16 66,277,345 - 66,288,852 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 66,277,345 - 66,288,852 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 71,555,983 - 71,567,493 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 74,962,293 - 74,973,803 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 70,202,187 - 70,213,697 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 71,046,475 - 71,057,883 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 71,046,475 - 71,057,883 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 70,711,151 - 70,722,559 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 70,652,831 - 70,663,995 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 70,653,556 - 70,663,907 (-) NCBI Celera 16 64,187,220 - 64,198,747 (-) NCBI Celera Cytogenetic Map 16 q12.4 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lsm1 Rat 1,2-dimethylhydrazine multiple interactions ISO Lsm1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LSM1 mRNA CTD PMID:22206623 Lsm1 Rat 17beta-estradiol increases expression ISO Lsm1 (Mus musculus) 6480464 Estradiol results in increased expression of LSM1 mRNA CTD PMID:39298647 Lsm1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO LSM1 (Homo sapiens) 6480464 Metribolone results in increased expression of LSM1 mRNA CTD PMID:17010196 Lsm1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Lsm1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Lsm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Lsm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of LSM1 mRNA CTD PMID:17949056 Lsm1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of LSM1 mRNA CTD PMID:21346803 Lsm1 Rat 4,4'-sulfonyldiphenol increases expression ISO Lsm1 (Mus musculus) 6480464 bisphenol S results in increased expression of LSM1 mRNA CTD PMID:39298647 Lsm1 Rat acrolein multiple interactions ISO LSM1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LSM1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of LSM1 mRNA CTD PMID:32699268 Lsm1 Rat acrylamide increases expression ISO LSM1 (Homo sapiens) 6480464 Acrylamide results in increased expression of LSM1 mRNA CTD PMID:32763439 Lsm1 Rat aflatoxin B1 decreases methylation ISO LSM1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of LSM1 gene CTD PMID:27153756 Lsm1 Rat alpha-pinene multiple interactions ISO LSM1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LSM1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of LSM1 mRNA CTD PMID:32699268 Lsm1 Rat aristolochic acid A increases expression ISO LSM1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of LSM1 mRNA CTD PMID:33212167 Lsm1 Rat arsane multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LSM1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LSM1 mRNA CTD PMID:39836092 Lsm1 Rat arsenic atom multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LSM1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LSM1 mRNA CTD PMID:39836092 Lsm1 Rat arsenite(3-) multiple interactions ISO LSM1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to LSM1 mRNA] CTD PMID:32406909 Lsm1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LSM1 mRNA CTD PMID:25181051 Lsm1 Rat bisphenol A decreases expression ISO LSM1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of LSM1 mRNA CTD PMID:29275510 Lsm1 Rat butan-1-ol multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of LSM1 mRNA CTD PMID:29432896 Lsm1 Rat cadmium atom multiple interactions ISO LSM1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LSM1 mRNA CTD PMID:35301059 Lsm1 Rat cadmium dichloride multiple interactions ISO LSM1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LSM1 mRNA CTD PMID:35301059 Lsm1 Rat carbon nanotube increases expression ISO Lsm1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of LSM1 mRNA CTD PMID:25554681 Lsm1 Rat Dibutyl phosphate affects expression ISO LSM1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of LSM1 mRNA CTD PMID:37042841 Lsm1 Rat dicrotophos decreases expression ISO LSM1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of LSM1 mRNA CTD PMID:28302478 Lsm1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of LSM1 mRNA CTD PMID:34044035 Lsm1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of LSM1 mRNA CTD PMID:24136188 Lsm1 Rat folic acid multiple interactions ISO Lsm1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LSM1 mRNA CTD PMID:22206623 Lsm1 Rat folic acid decreases expression ISO Lsm1 (Mus musculus) 6480464 Folic Acid results in decreased expression of LSM1 mRNA CTD PMID:25629700 Lsm1 Rat hydrogen peroxide affects expression ISO LSM1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of LSM1 mRNA CTD PMID:20044591 Lsm1 Rat ivermectin decreases expression ISO LSM1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of LSM1 protein CTD PMID:32959892 Lsm1 Rat levetiracetam increases expression EXP 6480464 Levetiracetam results in increased expression of LSM1 mRNA CTD PMID:20345932 Lsm1 Rat manganese atom multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LSM1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of LSM1 mRNA CTD PMID:39836092 Lsm1 Rat manganese(0) multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LSM1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of LSM1 mRNA CTD PMID:39836092 Lsm1 Rat manganese(II) chloride multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LSM1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of LSM1 mRNA CTD PMID:39836092 Lsm1 Rat nitrates multiple interactions ISO Lsm1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of LSM1 mRNA CTD PMID:35964746 Lsm1 Rat ozone multiple interactions ISO LSM1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LSM1 mRNA more ... CTD PMID:32699268 Lsm1 Rat paraquat increases expression ISO LSM1 (Homo sapiens) 6480464 Paraquat results in increased expression of LSM1 mRNA alternative form CTD PMID:17064354 Lsm1 Rat phenytoin decreases expression EXP 6480464 Phenytoin results in decreased expression of LSM1 mRNA CTD PMID:20345932 Lsm1 Rat pirinixic acid increases expression ISO Lsm1 (Mus musculus) 6480464 pirinixic acid results in increased expression of LSM1 mRNA CTD PMID:18301758 Lsm1 Rat potassium dichromate decreases expression ISO LSM1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of LSM1 protein CTD PMID:23718831 Lsm1 Rat rotenone increases expression ISO LSM1 (Homo sapiens) 6480464 Rotenone results in increased expression of LSM1 mRNA CTD PMID:33512557 Lsm1 Rat silver atom affects expression ISO Lsm1 (Mus musculus) 6480464 Silver affects the expression of LSM1 mRNA CTD PMID:27131904 Lsm1 Rat silver(0) affects expression ISO Lsm1 (Mus musculus) 6480464 Silver affects the expression of LSM1 mRNA CTD PMID:27131904 Lsm1 Rat sodium arsenite multiple interactions ISO LSM1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LSM1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LSM1 mRNA CTD PMID:39836092 Lsm1 Rat sodium fluoride decreases expression ISO Lsm1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of LSM1 mRNA CTD PMID:27862939 Lsm1 Rat succimer multiple interactions ISO Lsm1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of LSM1 mRNA CTD PMID:21641980
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) fipronil (EXP) flutamide (EXP) folic acid (ISO) hydrogen peroxide (ISO) ivermectin (ISO) levetiracetam (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) nitrates (ISO) ozone (ISO) paraquat (ISO) phenytoin (EXP) pirinixic acid (ISO) potassium dichromate (ISO) rotenone (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium fluoride (ISO) succimer (ISO)
Lsm1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 72,980,075 - 72,991,581 (-) NCBI GRCr8 mRatBN7.2 16 66,277,345 - 66,288,852 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 66,277,345 - 66,288,852 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 71,555,983 - 71,567,493 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 74,962,293 - 74,973,803 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 70,202,187 - 70,213,697 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 71,046,475 - 71,057,883 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 71,046,475 - 71,057,883 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 70,711,151 - 70,722,559 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 70,652,831 - 70,663,995 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 70,653,556 - 70,663,907 (-) NCBI Celera 16 64,187,220 - 64,198,747 (-) NCBI Celera Cytogenetic Map 16 q12.4 NCBI
LSM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 38,163,321 - 38,176,730 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 38,163,335 - 38,176,730 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 38,020,839 - 38,034,248 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 38,140,014 - 38,153,183 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 38,140,013 - 38,153,183 NCBI Celera 8 36,973,393 - 36,986,562 (-) NCBI Celera Cytogenetic Map 8 p11.23 NCBI HuRef 8 36,555,756 - 36,568,636 (-) NCBI HuRef CHM1_1 8 38,222,844 - 38,236,249 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 38,440,300 - 38,453,709 (-) NCBI T2T-CHM13v2.0
Lsm1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 26,275,326 - 26,294,003 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 26,275,316 - 26,294,003 (+) Ensembl GRCm39 Ensembl GRCm38 8 25,785,318 - 25,803,975 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 25,785,288 - 25,803,975 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 26,896,063 - 26,914,447 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 27,250,852 - 27,269,520 (+) NCBI MGSCv36 mm8 Celera 8 27,253,809 - 27,272,186 (+) NCBI Celera Cytogenetic Map 8 A2 NCBI cM Map 8 14.17 NCBI
Lsm1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955463 13,773,869 - 13,788,784 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955463 13,775,639 - 13,788,784 (-) NCBI ChiLan1.0 ChiLan1.0
LSM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 56,726,906 - 56,739,998 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 32,443,915 - 32,457,154 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 37,465,986 - 37,479,186 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 34,642,938 - 34,656,142 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 34,642,938 - 34,656,142 (-) Ensembl panpan1.1 panPan2
LSM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 27,304,257 - 27,315,389 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 27,304,198 - 27,315,233 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 27,821,271 - 27,832,688 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 29,203,163 - 29,214,621 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 29,203,401 - 29,214,465 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 27,425,471 - 27,436,928 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 28,002,718 - 28,014,129 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 28,041,959 - 28,053,408 (+) NCBI UU_Cfam_GSD_1.0
Lsm1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 49,909,516 - 49,915,246 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936710 1,545,790 - 1,552,394 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936710 1,546,027 - 1,551,685 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LSM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 48,348,648 - 48,365,106 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 48,348,653 - 48,360,004 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 55,604,059 - 55,615,385 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LSM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 36,184,928 - 36,198,689 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 36,182,380 - 36,198,704 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 5,791,244 - 5,805,004 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lsm1
.
Predicted Target Of
Count of predictions: 427 Count of miRNA genes: 217 Interacting mature miRNAs: 255 Transcripts: ENSRNOT00000020721 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 631525 Pia14 Pristane induced arthritis QTL 14 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 16 55711087 83402471 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 7411648 Foco22 Food consumption QTL 22 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 52726464 84729064 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 8694364 Abfw7 Abdominal fat weight QTL 7 12.22 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 16 52726464 84729064 Rat 8694429 Bw164 Body weight QTL 164 5 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 16 52726464 84729064 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020721 ⟹ ENSRNOP00000020721
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 66,277,345 - 66,288,852 (-) Ensembl Rnor_6.0 Ensembl 16 71,046,475 - 71,057,883 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118602 ⟹ ENSRNOP00000089972
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 66,277,345 - 66,283,881 (-) Ensembl
RefSeq Acc Id:
NM_001108876 ⟹ NP_001102346
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 72,980,075 - 72,991,581 (-) NCBI mRatBN7.2 16 66,277,345 - 66,288,852 (-) NCBI Rnor_6.0 16 71,046,475 - 71,057,883 (-) NCBI Rnor_5.0 16 70,711,151 - 70,722,559 (-) NCBI RGSC_v3.4 16 70,652,831 - 70,663,995 (-) RGD Celera 16 64,187,220 - 64,198,747 (-) RGD
Sequence:
CGCCGAGTGCCGAGCGGTCATGGACTGTACGGATCAACCCGGGCCTCGGAGCAGGAAAGCGAGGCGAGGGACAGCGCTTGTCACGAGTGAGGAAACGCCTATTCTCCGCCCTTCCGACCTGGACTTCA
hide sequence
RefSeq Acc Id:
NP_001102346 ⟸ NM_001108876
- UniProtKB:
D3ZWB1 (UniProtKB/TrEMBL), A6IW03 (UniProtKB/TrEMBL), A0A8I6GHU0 (UniProtKB/TrEMBL)
- Sequence:
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGRKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQSRLEAEKLKVQALKDRGLSIPRAD
hide sequence
Ensembl Acc Id:
ENSRNOP00000020721 ⟸ ENSRNOT00000020721
Ensembl Acc Id:
ENSRNOP00000089972 ⟸ ENSRNOT00000118602
RGD ID: 13700166 Promoter ID: EPDNEW_R10690 Type: initiation region Name: Lsm1_1 Description: LSM1 homolog, mRNA degradation associated SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 71,057,642 - 71,057,702 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-09
Lsm1
LSM1 homolog, mRNA degradation associated
Lsm1
LSM1 mRNA degradation associated
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-01
Lsm1
LSM1 mRNA degradation associated
Lsm1
LSM1, U6 small nuclear RNA associated
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-03-07
Lsm1
LSM1, U6 small nuclear RNA associated
Lsm1
LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Lsm1
LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Lsm1_predicted
LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Lsm1_predicted
LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820 APPROVED
