Symbol:
Pa2g4
Name:
proliferation-associated 2G4
RGD ID:
1302994
Description:
Predicted to enable nucleic acid binding activity; transcription corepressor activity; and ubiquitin protein ligase binding activity. Involved in negative regulation of apoptotic process and positive regulation of cell differentiation. Located in cytoplasm and nucleolus. Orthologous to human PA2G4 (proliferation-associated 2G4); INTERACTS WITH (+)-schisandrin B; 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ebp1; ErbB3-binding protein 1; MGC94070; proliferation-associated 2G4, 38kDa; proliferation-associated protein 2G4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,569,326 - 1,576,794 (-) NCBI GRCr8 mRatBN7.2 7 984,795 - 992,264 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 983,971 - 992,331 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 3,746,905 - 3,754,373 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 5,622,896 - 5,630,363 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 5,920,502 - 5,927,971 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 2,979,587 - 2,987,055 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 2,979,588 - 2,987,055 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 2,952,383 - 2,960,679 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 1,846,628 - 1,854,096 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 1,846,628 - 1,854,096 (-) NCBI Celera 7 855,183 - 862,626 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pa2g4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PA2G4 mRNA] CTD PMID:31150632 Pa2g4 Rat (-)-epigallocatechin 3-gallate increases expression ISO PA2G4 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PA2G4 protein CTD PMID:31195006 Pa2g4 Rat 1,2-dichloroethane increases expression ISO Pa2g4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of PA2G4 mRNA CTD PMID:28960355 Pa2g4 Rat 17alpha-ethynylestradiol increases expression ISO Pa2g4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PA2G4 mRNA CTD PMID:17555576 and PMID:17942748 Pa2g4 Rat 17alpha-ethynylestradiol multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PA2G4 mRNA CTD PMID:17942748 Pa2g4 Rat 17beta-estradiol decreases expression ISO PA2G4 (Homo sapiens) 6480464 Estradiol results in decreased expression of PA2G4 mRNA CTD PMID:16705744 Pa2g4 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO PA2G4 (Homo sapiens) 6480464 PA2G4 protein inhibits the reaction [Cyproterone Acetate promotes the reaction [Metribolone results in increased expression of AR mRNA]] and PA2G4 protein inhibits the reaction [Metribolone results in increased expression of AR mRNA] CTD PMID:15994225 Pa2g4 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO Pa2g4 (Mus musculus) 6480464 Dihydrotestosterone results in increased expression of PA2G4 mRNA CTD PMID:17023530 Pa2g4 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Pa2g4 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Pa2g4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pa2g4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PA2G4 mRNA CTD PMID:24058054 Pa2g4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pa2g4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PA2G4 mRNA CTD PMID:21570461 Pa2g4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pa2g4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PA2G4 mRNA CTD PMID:17942748 and PMID:19770486 Pa2g4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PA2G4 mRNA CTD PMID:17942748 Pa2g4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Pa2g4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PA2G4 mRNA CTD PMID:21346803 Pa2g4 Rat 2,6-dimethoxyphenol multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PA2G4 protein CTD PMID:38598786 Pa2g4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PA2G4 mRNA CTD PMID:21346803 Pa2g4 Rat 2-amino-14,16-dimethyloctadecan-3-ol increases expression ISO PA2G4 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in increased expression of PA2G4 protein CTD PMID:32044396 Pa2g4 Rat 2-hydroxypropanoic acid increases expression ISO PA2G4 (Homo sapiens) 6480464 Lactic Acid results in increased expression of PA2G4 mRNA CTD PMID:30851411 Pa2g4 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Pa2g4 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Pa2g4 Rat 4,4'-sulfonyldiphenol increases expression ISO PA2G4 (Homo sapiens) 6480464 bisphenol S results in increased expression of PA2G4 protein CTD PMID:34186270 Pa2g4 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PA2G4 mRNA CTD PMID:21346803 Pa2g4 Rat 4-hydroxynon-2-enal increases expression ISO Pa2g4 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of PA2G4 mRNA CTD PMID:19191707 Pa2g4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PA2G4 mRNA CTD PMID:24780913 Pa2g4 Rat actinomycin D multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PA2G4 protein CTD PMID:38460933 Pa2g4 Rat aflatoxin B1 increases expression ISO PA2G4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PA2G4 mRNA CTD PMID:27153756 Pa2g4 Rat all-trans-retinoic acid decreases expression ISO PA2G4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PA2G4 mRNA CTD PMID:16054129 Pa2g4 Rat ampicillin increases expression ISO PA2G4 (Homo sapiens) 6480464 Ampicillin results in increased expression of PA2G4 mRNA CTD PMID:21632981 Pa2g4 Rat aristolochic acid A increases expression ISO PA2G4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PA2G4 protein CTD PMID:33212167 Pa2g4 Rat arsenite(3-) multiple interactions ISO PA2G4 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PA2G4 mRNA] CTD PMID:32406909 Pa2g4 Rat belinostat decreases expression ISO PA2G4 (Homo sapiens) 6480464 belinostat results in decreased expression of PA2G4 mRNA CTD PMID:19606018 Pa2g4 Rat benzatropine multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of PA2G4 protein CTD PMID:34122009 Pa2g4 Rat benzo[a]pyrene increases expression ISO Pa2g4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PA2G4 mRNA CTD PMID:19770486 and PMID:20504355 Pa2g4 Rat benzo[a]pyrene multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PA2G4 mRNA CTD PMID:27858113 Pa2g4 Rat benzo[b]fluoranthene multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PA2G4 mRNA CTD PMID:27858113 Pa2g4 Rat bicalutamide multiple interactions ISO PA2G4 (Homo sapiens) 6480464 bicalutamide promotes the reaction [PA2G4 protein binds to KLK3 promoter] CTD PMID:15994225 Pa2g4 Rat bicalutamide increases response to substance ISO PA2G4 (Homo sapiens) 6480464 PA2G4 protein results in increased susceptibility to bicalutamide CTD PMID:15994225 Pa2g4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PA2G4 mRNA CTD PMID:25181051 and PMID:34947998 Pa2g4 Rat bisphenol A decreases methylation ISO PA2G4 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PA2G4 gene CTD PMID:31601247 Pa2g4 Rat bisphenol A multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PA2G4 gene CTD PMID:31601247 Pa2g4 Rat bisphenol A decreases expression ISO PA2G4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PA2G4 mRNA and bisphenol A results in decreased expression of PA2G4 protein CTD PMID:33670352 more ... Pa2g4 Rat bisphenol A decreases expression ISO Pa2g4 (Mus musculus) 6480464 bisphenol A results in decreased expression of PA2G4 mRNA CTD PMID:33221593 Pa2g4 Rat bisphenol A affects methylation ISO Pa2g4 (Mus musculus) 6480464 bisphenol A affects the methylation of PA2G4 promoter CTD PMID:27334623 Pa2g4 Rat bisphenol AF increases expression ISO PA2G4 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PA2G4 mRNA and bisphenol AF results in increased expression of PA2G4 protein CTD PMID:34186270 and PMID:36190352 Pa2g4 Rat Bisphenol B increases expression ISO PA2G4 (Homo sapiens) 6480464 bisphenol B results in increased expression of PA2G4 protein CTD PMID:34186270 Pa2g4 Rat bisphenol F increases expression ISO PA2G4 (Homo sapiens) 6480464 bisphenol F results in increased expression of PA2G4 protein CTD PMID:34186270 Pa2g4 Rat cadmium dichloride multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of PA2G4 mRNA CTD PMID:19840844 Pa2g4 Rat caffeine decreases phosphorylation ISO PA2G4 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PA2G4 protein CTD PMID:35688186 Pa2g4 Rat carbon nanotube decreases expression ISO PA2G4 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of PA2G4 mRNA CTD PMID:15585362 Pa2g4 Rat carbon nanotube increases expression ISO Pa2g4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pa2g4 Rat carbon nanotube increases expression ISO PA2G4 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of PA2G4 protein CTD PMID:22157353 Pa2g4 Rat CGP 52608 multiple interactions ISO PA2G4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PA2G4 gene] CTD PMID:28238834 Pa2g4 Rat chloropicrin decreases expression ISO PA2G4 (Homo sapiens) 6480464 chloropicrin results in decreased expression of PA2G4 mRNA CTD PMID:26352163 Pa2g4 Rat chlorpyrifos decreases expression ISO Pa2g4 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PA2G4 mRNA CTD PMID:37019170 Pa2g4 Rat choline multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PA2G4 gene CTD PMID:20938992 Pa2g4 Rat chromium(6+) affects expression ISO Pa2g4 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PA2G4 mRNA CTD PMID:28472532 Pa2g4 Rat chrysene multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PA2G4 mRNA CTD PMID:27858113 Pa2g4 Rat cisplatin decreases expression ISO Pa2g4 (Mus musculus) 6480464 Cisplatin results in decreased expression of PA2G4 mRNA CTD PMID:21151649 Pa2g4 Rat cisplatin increases expression ISO PA2G4 (Homo sapiens) 6480464 Cisplatin results in increased expression of PA2G4 mRNA CTD PMID:27392435 Pa2g4 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PA2G4 mRNA CTD PMID:17602206 Pa2g4 Rat cobalt dichloride decreases expression ISO PA2G4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PA2G4 mRNA CTD PMID:19376846 Pa2g4 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PA2G4 mRNA CTD PMID:17898221 Pa2g4 Rat copper atom multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of PA2G4 mRNA CTD PMID:15467011 Pa2g4 Rat copper(0) multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of PA2G4 mRNA CTD PMID:15467011 Pa2g4 Rat Cuprizon multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of PA2G4 protein CTD PMID:34122009 Pa2g4 Rat cycloheximide multiple interactions ISO PA2G4 (Homo sapiens) 6480464 PA2G4 protein promotes the reaction [Cycloheximide results in decreased expression of ERBB2 protein] CTD PMID:20379846 Pa2g4 Rat cyclosporin A decreases expression ISO Pa2g4 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PA2G4 mRNA CTD PMID:25270620 Pa2g4 Rat cyclosporin A increases expression ISO PA2G4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PA2G4 mRNA CTD PMID:25562108 Pa2g4 Rat cyproterone acetate multiple interactions ISO PA2G4 (Homo sapiens) 6480464 PA2G4 protein inhibits the reaction [Cyproterone Acetate promotes the reaction [Metribolone results in increased expression of AR mRNA]] and PA2G4 protein inhibits the reaction [Cyproterone Acetate results in increased expression of AR mRNA] CTD PMID:15994225 Pa2g4 Rat DDE increases expression ISO PA2G4 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PA2G4 mRNA CTD PMID:38568856 Pa2g4 Rat Dibutyl phosphate affects expression ISO PA2G4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PA2G4 mRNA CTD PMID:37042841 Pa2g4 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PA2G4 mRNA CTD PMID:21266533 Pa2g4 Rat dibutyl phthalate decreases expression ISO Pa2g4 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PA2G4 mRNA CTD PMID:17361019 and PMID:21266533 Pa2g4 Rat diethylstilbestrol decreases expression ISO PA2G4 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of PA2G4 mRNA CTD PMID:36621641 Pa2g4 Rat dioxygen multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PA2G4 mRNA CTD PMID:30529165 Pa2g4 Rat doxorubicin decreases expression EXP 156430329 doxorubicin decreases expression of Pa2g4 mRNA and protein in cardiomyocytes RGD Pa2g4 Rat elemental selenium multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of PA2G4 mRNA CTD PMID:19244175 Pa2g4 Rat enzyme inhibitor multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PA2G4 protein CTD PMID:23301498 Pa2g4 Rat fenthion increases expression ISO Pa2g4 (Mus musculus) 6480464 Fenthion results in increased expression of PA2G4 mRNA CTD PMID:34813904 Pa2g4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PA2G4 mRNA CTD PMID:24136188 Pa2g4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PA2G4 mRNA CTD PMID:19299419 and PMID:24136188 Pa2g4 Rat folic acid multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PA2G4 gene CTD PMID:20938992 Pa2g4 Rat folic acid decreases expression ISO PA2G4 (Homo sapiens) 6480464 Folic Acid results in decreased expression of PA2G4 mRNA CTD PMID:21867686 Pa2g4 Rat folic acid decreases expression ISO Pa2g4 (Mus musculus) 6480464 Folic Acid results in decreased expression of PA2G4 mRNA CTD PMID:25629700 Pa2g4 Rat FR900359 affects phosphorylation ISO PA2G4 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PA2G4 protein CTD PMID:37730182 Pa2g4 Rat fulvestrant multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PA2G4 gene CTD PMID:31601247 Pa2g4 Rat furfural multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PA2G4 protein CTD PMID:38598786 Pa2g4 Rat genistein decreases expression ISO PA2G4 (Homo sapiens) 6480464 Genistein results in decreased expression of PA2G4 mRNA CTD PMID:16705744 Pa2g4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PA2G4 protein CTD PMID:22061828 Pa2g4 Rat geraniol decreases expression ISO PA2G4 (Homo sapiens) 6480464 geraniol results in decreased expression of PA2G4 mRNA CTD PMID:27683099 Pa2g4 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of PA2G4 mRNA CTD PMID:24136188 Pa2g4 Rat graphite increases expression ISO PA2G4 (Homo sapiens) 6480464 Graphite results in increased expression of PA2G4 protein CTD PMID:22157353 Pa2g4 Rat hydrogen peroxide affects expression ISO PA2G4 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PA2G4 mRNA CTD PMID:21179406 Pa2g4 Rat hydroquinone affects expression ISO PA2G4 (Homo sapiens) 6480464 hydroquinone affects the expression of PA2G4 protein CTD PMID:17181942 Pa2g4 Rat ivermectin decreases expression ISO PA2G4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PA2G4 protein CTD PMID:32959892 Pa2g4 Rat L-methionine multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PA2G4 gene CTD PMID:20938992 Pa2g4 Rat lead diacetate decreases expression ISO Pa2g4 (Mus musculus) 6480464 lead acetate results in decreased expression of PA2G4 mRNA CTD PMID:21335049 Pa2g4 Rat lovastatin increases expression ISO Pa2g4 (Mus musculus) 6480464 Lovastatin results in increased expression of PA2G4 mRNA CTD PMID:20493250 Pa2g4 Rat methidathion increases expression ISO Pa2g4 (Mus musculus) 6480464 methidathion results in increased expression of PA2G4 mRNA CTD PMID:34813904 Pa2g4 Rat miconazole increases expression ISO Pa2g4 (Mus musculus) 6480464 Miconazole results in increased expression of PA2G4 mRNA CTD PMID:27462272 Pa2g4 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of PA2G4 mRNA CTD PMID:19840844 Pa2g4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PA2G4 mRNA CTD PMID:17602206 Pa2g4 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PA2G4 mRNA CTD PMID:24136188 Pa2g4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PA2G4 mRNA CTD PMID:24136188 Pa2g4 Rat nitrates multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PA2G4 mRNA CTD PMID:35964746 Pa2g4 Rat Nutlin-3 multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PA2G4 protein CTD PMID:38460933 Pa2g4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PA2G4 mRNA CTD PMID:25729387 Pa2g4 Rat ozone multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PA2G4 mRNA CTD PMID:34911549 Pa2g4 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PA2G4 mRNA CTD PMID:32680482 Pa2g4 Rat phenobarbital affects expression ISO Pa2g4 (Mus musculus) 6480464 Phenobarbital affects the expression of PA2G4 mRNA CTD PMID:23091169 Pa2g4 Rat piroxicam increases expression ISO PA2G4 (Homo sapiens) 6480464 Piroxicam results in increased expression of PA2G4 mRNA CTD PMID:21858171 Pa2g4 Rat quercetin decreases expression ISO PA2G4 (Homo sapiens) 6480464 Quercetin results in decreased expression of PA2G4 protein CTD PMID:15221776 Pa2g4 Rat quercetin increases expression ISO PA2G4 (Homo sapiens) 6480464 Quercetin results in increased expression of PA2G4 mRNA CTD PMID:21632981 Pa2g4 Rat rac-lactic acid increases expression ISO PA2G4 (Homo sapiens) 6480464 Lactic Acid results in increased expression of PA2G4 mRNA CTD PMID:30851411 Pa2g4 Rat selenium atom multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of PA2G4 mRNA CTD PMID:19244175 Pa2g4 Rat silicon dioxide increases expression ISO PA2G4 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PA2G4 mRNA CTD PMID:25895662 Pa2g4 Rat sodium arsenite increases expression ISO PA2G4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PA2G4 mRNA CTD PMID:28595984 and PMID:34032870 Pa2g4 Rat sodium arsenite multiple interactions ISO PA2G4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of and results in increased activity of PA2G4 protein CTD PMID:30528433 Pa2g4 Rat sodium arsenite decreases expression ISO PA2G4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PA2G4 mRNA CTD PMID:38568856 Pa2g4 Rat sodium chloride multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PA2G4 protein more ... CTD PMID:38598786 Pa2g4 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of PA2G4 mRNA CTD PMID:25993096 Pa2g4 Rat sunitinib decreases expression ISO PA2G4 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PA2G4 mRNA CTD PMID:31533062 Pa2g4 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PA2G4 protein CTD PMID:26141394 Pa2g4 Rat tamoxifen multiple interactions ISO PA2G4 (Homo sapiens) 6480464 ERBB2 protein inhibits the reaction [PA2G4 protein results in increased susceptibility to Tamoxifen] CTD PMID:20379846 Pa2g4 Rat tamoxifen affects expression ISO Pa2g4 (Mus musculus) 6480464 Tamoxifen affects the expression of PA2G4 mRNA CTD PMID:17555576 Pa2g4 Rat tamoxifen increases response to substance ISO PA2G4 (Homo sapiens) 6480464 PA2G4 protein results in increased susceptibility to Tamoxifen CTD PMID:20379846 Pa2g4 Rat tanespimycin increases expression ISO PA2G4 (Homo sapiens) 6480464 tanespimycin analog results in increased expression of PA2G4 protein and tanespimycin results in increased expression of PA2G4 protein CTD PMID:31370342 Pa2g4 Rat tanespimycin multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [tanespimycin co-treated with VER 155008] results in increased expression of PA2G4 protein CTD PMID:31370342 Pa2g4 Rat Tetrachlorobisphenol A multiple interactions ISO Pa2g4 (Mus musculus) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of PA2G4 mRNA] CTD PMID:37992829 Pa2g4 Rat Tetrachlorobisphenol A increases expression ISO Pa2g4 (Mus musculus) 6480464 tetrachlorodian results in increased expression of PA2G4 mRNA CTD PMID:37992829 Pa2g4 Rat Tetrachlorobisphenol A affects expression EXP 6480464 tetrachlorodian affects the expression of PA2G4 mRNA CTD PMID:37992829 Pa2g4 Rat tetrachloromethane increases expression ISO Pa2g4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PA2G4 mRNA CTD PMID:27339419 and PMID:31919559 Pa2g4 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PA2G4 mRNA CTD PMID:31150632 Pa2g4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PA2G4 mRNA] CTD PMID:31150632 Pa2g4 Rat tetraphene multiple interactions ISO Pa2g4 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of PA2G4 mRNA CTD PMID:27858113 Pa2g4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PA2G4 mRNA CTD PMID:23411599 and PMID:34492290 Pa2g4 Rat thiram decreases expression ISO PA2G4 (Homo sapiens) 6480464 Thiram results in decreased expression of PA2G4 mRNA CTD PMID:38568856 Pa2g4 Rat titanium dioxide decreases methylation ISO Pa2g4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PA2G4 gene and titanium dioxide results in decreased methylation of PA2G4 promoter CTD PMID:35295148 Pa2g4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PA2G4 mRNA CTD PMID:25729387 Pa2g4 Rat trimellitic anhydride increases expression ISO Pa2g4 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PA2G4 mRNA CTD PMID:19042947 Pa2g4 Rat valproic acid affects expression ISO Pa2g4 (Mus musculus) 6480464 Valproic Acid affects the expression of PA2G4 mRNA CTD PMID:17292431 Pa2g4 Rat vitamin E multiple interactions ISO PA2G4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of PA2G4 mRNA CTD PMID:19244175 Pa2g4 Rat warfarin increases expression ISO Pa2g4 (Mus musculus) 6480464 Warfarin results in increased expression of PA2G4 mRNA CTD PMID:20493250 Pa2g4 Rat wortmannin multiple interactions ISO Pa2g4 (Mus musculus) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of PA2G4 mRNA] CTD PMID:37992829 Pa2g4 Rat zinc sulfate affects expression ISO PA2G4 (Homo sapiens) 6480464 Zinc Sulfate affects the expression of PA2G4 protein CTD PMID:25162517
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ampicillin (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) belinostat (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bicalutamide (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) chrysene (ISO) cisplatin (ISO) clofibric acid (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (ISO) cycloheximide (ISO) cyclosporin A (ISO) cyproterone acetate (ISO) DDE (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (EXP) elemental selenium (ISO) enzyme inhibitor (ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) geraniol (ISO) glafenine (EXP) graphite (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (ISO) lovastatin (ISO) methidathion (ISO) miconazole (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) paraquat (EXP) phenobarbital (ISO) piroxicam (ISO) quercetin (ISO) rac-lactic acid (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sunitinib (ISO) T-2 toxin (EXP) tamoxifen (ISO) tanespimycin (ISO) Tetrachlorobisphenol A (EXP,ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trimellitic anhydride (ISO) valproic acid (ISO) vitamin E (ISO) warfarin (ISO) wortmannin (ISO) zinc sulfate (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Ebp1 isoforms distinctively regulate cell survival and differentiation.
Liu Z, etal., Proc Natl Acad Sci U S A. 2006 Jul 18;103(29):10917-22. Epub 2006 Jul 10.
4.
GOA pipeline
RGD automated data pipeline
5.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
EBP1 is a nucleolar growth-regulating protein that is part of pre-ribosomal ribonucleoprotein complexes.
Squatrito M, etal., Oncogene 2004 May 27;23(25):4454-65.
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.
The long non-coding RNA H19 promotes cardiomyocyte apoptosis in dilated cardiomyopathy.
Zhang Y, etal., Oncotarget. 2017 Apr 25;8(17):28588-28594. doi: 10.18632/oncotarget.15544.
Pa2g4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 1,569,326 - 1,576,794 (-) NCBI GRCr8 mRatBN7.2 7 984,795 - 992,264 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 983,971 - 992,331 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 3,746,905 - 3,754,373 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 5,622,896 - 5,630,363 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 5,920,502 - 5,927,971 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 2,979,587 - 2,987,055 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 2,979,588 - 2,987,055 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 2,952,383 - 2,960,679 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 1,846,628 - 1,854,096 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 1,846,628 - 1,854,096 (-) NCBI Celera 7 855,183 - 862,626 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
PA2G4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 56,104,559 - 56,113,910 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 56,104,537 - 56,113,910 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 56,498,343 - 56,507,694 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 54,784,370 - 54,793,961 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 54,784,691 - 54,793,353 NCBI Celera 12 56,150,290 - 56,159,843 (+) NCBI Celera Cytogenetic Map 12 q13.2 NCBI HuRef 12 53,537,242 - 53,546,835 (+) NCBI HuRef CHM1_1 12 56,465,468 - 56,475,059 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 56,072,163 - 56,081,516 (+) NCBI T2T-CHM13v2.0
Pa2g4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 128,393,635 - 128,401,803 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 128,393,635 - 128,401,856 (-) Ensembl GRCm39 Ensembl GRCm38 10 128,557,766 - 128,565,934 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 128,557,766 - 128,565,987 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 127,994,822 - 128,002,990 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 127,961,592 - 127,968,897 (-) NCBI MGSCv36 mm8 Celera 10 130,949,754 - 130,957,922 (-) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 77.09 NCBI
Pa2g4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 3,705,704 - 3,717,403 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 3,705,704 - 3,715,782 (+) NCBI ChiLan1.0 ChiLan1.0
PA2G4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 38,218,516 - 38,227,001 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 38,214,527 - 38,224,146 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 32,801,085 - 32,810,441 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 33,051,672 - 33,061,262 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 33,051,672 - 33,061,262 (-) Ensembl panpan1.1 panPan2
PA2G4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 426,074 - 437,044 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 426,069 - 434,767 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 487,811 - 499,123 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 432,937 - 444,249 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 432,930 - 441,669 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 410,400 - 421,711 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 653,296 - 664,836 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 777,521 - 788,835 (+) NCBI UU_Cfam_GSD_1.0
Pa2g4
PA2G4
PA2G4
Pa2g4
.
Predicted Target Of
Count of predictions: 129 Count of miRNA genes: 99 Interacting mature miRNAs: 104 Transcripts: ENSRNOT00000006578 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
RH139015
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 1,569,946 - 1,570,173 (+) Marker Load Pipeline mRatBN7.2 7 985,415 - 985,642 (+) MAPPER mRatBN7.2 Rnor_6.0 7 2,980,208 - 2,980,434 NCBI Rnor6.0 Rnor_5.0 7 2,953,832 - 2,954,058 UniSTS Rnor5.0 RGSC_v3.4 7 1,847,249 - 1,847,475 UniSTS RGSC3.4 Celera 7 855,804 - 856,030 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006578 ⟹ ENSRNOP00000006578
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 984,807 - 992,331 (-) Ensembl Rnor_6.0 Ensembl 7 2,979,588 - 2,987,055 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081125 ⟹ ENSRNOP00000069595
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 985,579 - 992,286 (-) Ensembl Rnor_6.0 Ensembl 7 2,980,380 - 2,986,935 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096142 ⟹ ENSRNOP00000091838
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 983,971 - 992,331 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096767 ⟹ ENSRNOP00000085880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 983,971 - 991,705 (-) Ensembl
RefSeq Acc Id:
NM_001004206 ⟹ NP_001004206
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 1,569,326 - 1,576,794 (-) NCBI mRatBN7.2 7 984,795 - 992,264 (-) NCBI Rnor_6.0 7 2,979,587 - 2,987,055 (-) NCBI Rnor_5.0 7 2,952,383 - 2,960,679 (-) NCBI RGSC_v3.4 7 1,846,628 - 1,854,096 (-) RGD Celera 7 855,183 - 862,626 (-) RGD
Sequence:
CCCTTGCTAGCTCGCGCTTTCCTCGCGGATCGAAGAGACTCCGGCTACAGCTTGTGGCTGGGAAGGGAGACGGAGGCCGCAGCTCAGGGAAAGTGAAGCTGCAGTAGTGGCAGTAGGAAGATGTCGGG
hide sequence
RefSeq Acc Id:
NP_001004206 ⟸ NM_001004206
- UniProtKB:
Q6AYD3 (UniProtKB/Swiss-Prot), A0A8L2UI00 (UniProtKB/TrEMBL)
- Sequence:
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIG
hide sequence
Ensembl Acc Id:
ENSRNOP00000006578 ⟸ ENSRNOT00000006578
Ensembl Acc Id:
ENSRNOP00000069595 ⟸ ENSRNOT00000081125
Ensembl Acc Id:
ENSRNOP00000091838 ⟸ ENSRNOT00000096142
Ensembl Acc Id:
ENSRNOP00000085880 ⟸ ENSRNOT00000096767
RGD ID: 13694944 Promoter ID: EPDNEW_R5469 Type: initiation region Name: Pa2g4_1 Description: proliferation-associated 2G4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 2,987,050 - 2,987,110 EPDNEW
BioCyc Gene G2FUF-35351 BioCyc
Ensembl Genes ENSRNOG00000004904 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000006578.6 UniProtKB/TrEMBL
ENSRNOT00000081125.2 UniProtKB/TrEMBL
ENSRNOT00000096142.1 UniProtKB/Swiss-Prot
ENSRNOT00000096767.1 UniProtKB/TrEMBL
Gene3D-CATH 1.10.10.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.90.230.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7124036 IMAGE-MGC_LOAD
InterPro Creatinase/aminopeptidase-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PA2G4 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PA2G4/ARX1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pept_M24 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pept_M24A_MAP2_BS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
WH-like_DNA-bd_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
WH_DNA-bd_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:288778 UniProtKB/Swiss-Prot
MGC_CLONE MGC:94070 IMAGE-MGC_LOAD
NCBI Gene 288778 ENTREZGENE
PANTHER PROLIFERATION-ASSOCIATED PROTEIN 2G4 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROTEASE FAMILY M24 METHIONYL AMINOPEPTIDASE, AMINOPEPTIDASE P UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Peptidase_M24 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Pa2g4 PhenoGen
PROSITE MAP_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000004904 RatGTEx
Superfamily-SCOP SSF46785 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF55920 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A0G2JVS2_RAT UniProtKB/TrEMBL
A0A8I6GDG3_RAT UniProtKB/TrEMBL
A0A8L2UI00 ENTREZGENE, UniProtKB/TrEMBL
A6KSF5_RAT UniProtKB/TrEMBL
PA2G4_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Pa2g4
proliferation-associated 2G4
Name updated
1299863 APPROVED
2005-02-14
Pa2g4
proliferation-associated 2G4, 38kDa
Symbol and Name status set to provisional
70820 PROVISIONAL
