Advanced Search (OLGA)

Gene: St8sia5 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5) Rattus norvegicus

Analyze

Symbol:

St8sia5

Name:

ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5

RGD ID:

1302934

Description:

Enables sialyltransferase activity. Involved in glycosphingolipid biosynthetic process. Located in Golgi membrane. Orthologous to human ST8SIA5 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5); PARTICIPATES IN ganglioside metabolic pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-2,8-sialyltransferase; alpha-2,8-sialyltransferase 8E; SATV; sialyltransferase 8E; sialyltransferase St8Sia V; SIAT8-E; SIAT8E; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 5; ST8SiaV

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	73,010,235 - 73,072,984 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	73,011,383 - 73,072,991 (+)	Ensembl				GRCr8
mRatBN7.2	18	70,736,395 - 70,802,537 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	70,736,602 - 70,797,789 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	72,839,313 - 72,900,072 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	73,508,522 - 73,569,285 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	71,365,117 - 71,425,878 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	73,564,010 - 73,630,256 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	73,564,247 - 73,625,137 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	73,242,401 - 73,305,796 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	74,163,989 - 74,224,969 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	69,258,554 - 69,319,155 (+)	NCBI		Celera
RGSC_v3.1	18	74,237,261 - 74,298,242 (+)	NCBI
Cytogenetic Map	18	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

butanal (ISO)

cadmium dichloride (EXP)

dibutyl phthalate (EXP)

doxorubicin (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

mono(2-ethylhexyl) phthalate (ISO)

paraquat (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

phenylephrine (EXP)

potassium dichromate (ISO)

propanal (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sunitinib (ISO)

testosterone (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

glycoprotein biosynthetic process (IEA)

glycosphingolipid biosynthetic process (IDA)

lipid metabolic process (IEA)

N-glycan processing (IBA)

oligosaccharide metabolic process (IBA)

Cellular Component

Golgi membrane (IDA,IEA)

Molecular Function

alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity (IBA,IEA,ISO)

glycosyltransferase activity (IEA)

protein binding (ISO)

sialyltransferase activity (IDA,IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ganglioside metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The c-series gangliosides GT3, GT2 and GP1c are formed in rat liver Golgi by the same set of glycosyltransferases that catalyse the biosynthesis of asialo-, a- and b-series gangliosides.	Iber H, etal., Glycobiology. 1992 Apr;2(2):137-42. doi: 10.1093/glycob/2.2.137.
3.	Molecular cloning and expression of a fifth type of alpha2,8-sialyltransferase (ST8Sia V). Its substrate specificity is similar to that of SAT-V/III, which synthesize GD1c, GT1a, GQ1b and GT3.	Kono M, etal., J Biol Chem 1996 Nov 15;271(46):29366-71.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15843597	PMID:19103603

Genomics

Comparative Map Data

St8sia5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	73,010,235 - 73,072,984 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	73,011,383 - 73,072,991 (+)	Ensembl				GRCr8
mRatBN7.2	18	70,736,395 - 70,802,537 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	70,736,602 - 70,797,789 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	72,839,313 - 72,900,072 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	73,508,522 - 73,569,285 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	71,365,117 - 71,425,878 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	73,564,010 - 73,630,256 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	73,564,247 - 73,625,137 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	73,242,401 - 73,305,796 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	74,163,989 - 74,224,969 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	69,258,554 - 69,319,155 (+)	NCBI		Celera
RGSC_v3.1	18	74,237,261 - 74,298,242 (+)	NCBI
Cytogenetic Map	18	q12.3	NCBI

ST8SIA5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	46,667,821 - 46,757,053 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	46,667,821 - 46,759,257 (-)	Ensembl			hg38	GRCh38
GRCh37	18	44,247,784 - 44,337,016 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	42,513,079 - 42,591,037 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	18	42,513,078 - 42,591,037	NCBI
Celera	18	41,066,687 - 41,144,720 (-)	NCBI		Celera
Cytogenetic Map	18	q21.1	NCBI
HuRef	18	41,116,714 - 41,194,741 (-)	NCBI		HuRef
CHM1_1	18	44,186,081 - 44,264,162 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	46,858,373 - 46,947,691 (-)	NCBI		T2T-CHM13v2.0

St8sia5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	77,273,529 - 77,343,146 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	77,273,535 - 77,346,467 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	77,185,847 - 77,255,450 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	77,185,839 - 77,258,771 (+)	Ensembl			mm10	GRCm38
MGSCv37	18	77,424,586 - 77,494,189 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	77,390,303 - 77,459,770 (+)	NCBI		MGSCv36	mm8
MGSCv36	18	77,608,620 - 77,678,315 (+)	NCBI		MGSCv36	mm8
Celera	18	78,368,567 - 78,438,780 (+)	NCBI		Celera
Cytogenetic Map	18	E3	NCBI
cM Map	18	52.13	NCBI

St8sia5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	32,165,912 - 32,232,674 (-)	Ensembl
ChiLan1.0	NW_004955402	32,165,912 - 32,232,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

ST8SIA5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	64,081,658 - 64,186,102 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	49,774,259 - 49,878,701 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	39,958,239 - 40,036,282 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	43,492,025 - 43,569,857 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	43,492,025 - 43,569,857 (-)	Ensembl			panPan2	panpan1.1

ST8SIA5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	44,583,638 - 44,656,823 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	44,591,092 - 44,646,048 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	44,075,723 - 44,139,749 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	44,545,565 - 44,602,115 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	44,545,565 - 44,598,988 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	44,245,521 - 44,309,622 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	44,299,526 - 44,363,613 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	44,583,294 - 44,647,319 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

St8sia5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	40,859,884 - 40,935,220 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936517	186,452 - 253,513 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936517	186,465 - 262,622 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ST8SIA5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	96,297,034 - 96,375,868 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	96,291,794 - 96,375,909 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ST8SIA5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	34,139,529 - 34,229,582 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	34,140,253 - 34,228,664 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	8,512,190 - 8,600,889 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

St8sia5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624778	10,305,450 - 10,389,625 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624778	10,293,685 - 10,390,340 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

St8sia5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	54,818,111 - 54,879,922 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in St8sia5
400 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	66
Interacting mature miRNAs:	68
Transcripts:	ENSRNOT00000035317
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	54490801	86134022	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	62892257	79484461	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	64383762	79484311	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	57825243	85493247	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
7794793	Mcs34	Mammary carcinoma susceptibility QTL 34	1.54		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	18	65635567	85897775	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	65846447	86134022	Rat
1598832	Glom11	Glomerulus QTL 11	2.9		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	53266671	86134022	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61982204	76619168	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	62892257	79484461	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	61446853	86134022	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	54490801	76272247	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat

Markers in Region

D18Got76

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	70,752,029 - 70,752,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,579,677 - 73,579,821	NCBI	Rnor6.0
Rnor_5.0	18	73,258,033 - 73,258,177	UniSTS	Rnor5.0
RGSC_v3.4	18	74,179,367 - 74,179,511	UniSTS	RGSC3.4
RGSC_v3.4	18	74,179,366 - 74,179,511	RGD	RGSC3.4
Celera	18	69,273,968 - 69,274,112	UniSTS
RGSC_v3.1	18	74,252,640 - 74,252,784	RGD
RH 3.4 Map	18	755.8	UniSTS
RH 3.4 Map	18	755.8	RGD
RH 2.0 Map	18	164.4	RGD
Cytogenetic Map	18	q12.3	UniSTS

X98014

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	70,797,582 - 70,797,704 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,625,218 - 73,625,339	NCBI	Rnor6.0
Rnor_5.0	18	73,303,102 - 73,303,223	UniSTS	Rnor5.0
RGSC_v3.4	18	74,225,246 - 74,225,367	UniSTS	RGSC3.4
Celera	18	69,319,432 - 69,319,553	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

RH139949

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	70,797,324 - 70,797,538 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,624,960 - 73,625,173	NCBI	Rnor6.0
Rnor_5.0	18	73,302,844 - 73,303,057	UniSTS	Rnor5.0
RGSC_v3.4	18	74,224,988 - 74,225,201	UniSTS	RGSC3.4
Celera	18	69,319,174 - 69,319,387	UniSTS
RH 3.4 Map	18	747.0	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

BF416672

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	70,771,601 - 70,771,851 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,599,245 - 73,599,494	NCBI	Rnor6.0
Rnor_5.0	18	73,277,807 - 73,278,056	UniSTS	Rnor5.0
RGSC_v3.4	18	74,198,935 - 74,199,184	UniSTS	RGSC3.4
Celera	18	69,293,515 - 69,293,764	UniSTS
RH 3.4 Map	18	745.3	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
7	11	64	150	53	52	26	28	26	6	220	124	9	129	55	78	26	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001413108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_213628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC139391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ699422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035317 ⟹ ENSRNOP00000033363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	73,011,402 - 73,072,982 (+)	Ensembl
mRatBN7.2 Ensembl	18	70,736,602 - 70,797,789 (+)	Ensembl
Rnor_6.0 Ensembl	18	73,564,312 - 73,624,941 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077679 ⟹ ENSRNOP00000069340

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	73,011,383 - 73,072,991 (+)	Ensembl
mRatBN7.2 Ensembl	18	70,736,602 - 70,797,789 (+)	Ensembl
Rnor_6.0 Ensembl	18	73,564,247 - 73,625,137 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000165782 ⟹ ENSRNOP00000107226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	73,011,402 - 73,072,982 (+)	Ensembl

RefSeq Acc Id:

NM_001413108 ⟹ NP_001400037

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,011,587 - 73,072,984 (+)	NCBI
mRatBN7.2	18	70,736,395 - 70,797,802 (+)	NCBI

RefSeq Acc Id:

NM_213628 ⟹ NP_998793

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,011,587 - 73,072,984 (+)	NCBI
mRatBN7.2	18	70,736,395 - 70,797,802 (+)	NCBI
Rnor_6.0	18	73,564,312 - 73,624,941 (+)	NCBI
Rnor_5.0	18	73,242,401 - 73,305,796 (+)	NCBI
RGSC_v3.4	18	74,163,989 - 74,224,969 (+)	RGD
Celera	18	69,258,554 - 69,319,155 (+)	RGD

Sequence:

show sequence

ATGCGCTACGCAGACCCCTCGGCCAACAGGGATTTGTTGGGGAACCGAACTTTGCTCTTCATCT
TCATCTGCGCCTTCGCCTTGGTGACCTTGCTCCAGCAGATCCTGTACAGCAAGAGCTACATCAA
GAGGTACTTCGAATTTTACAAGGAACCTTTAGAATTTAACTCCACGAGATGCCTGGAGCTGAGG
CAGGAGATCCTGGAGGTGAAGGTGCTGTCCATGGTGAAGCAGTCTGAACTGTTCGAAAGGTGGA
AGAGCCTCCAGATATGCAAATGGGCGATGGACGCCTCGGAAGCCAGCCTCTTCAAGTCCACCTT
GTCCAGGTGTTGCAATGCCCCCAACTTTCTCTTCACCACCCAGAAGAACACCCCGGTTGAGACG
AATCTCAGGTATGAGGTGGAGTCCAGTGGCTTGTATCACATCGACCAAGAGATCTTCAAAATGT
TTCCCAAGGAAATGCCCTACTACCGCTCTCAGTTTAAGAAGTGTGCTGTGGTGGGCAATGGCGG
CATCTTGAAGAACAGCGGCTGCGGGAAGGAGATCAACAGCGCTGACTTCGTCTTCCGGTGCAAT
CTGCCCCCTATCTCAGGGATATATACCACAGATGTGGGAGAGAAGACAGATGTGGTCACCGTGA
ATCCCAGCATCATAATTGACAGGTTCCACAAGTTGGAGAAGTGGCGGCGGCCCTTCTTCAGCGT
GCTGCAGAGGTACGAGAACGCCTCGGTGCTGCTGCCGGCCTTCTACAATGTGCGCAACACCCTC
GTGTCCTTCCGAGTCAAGTACATGCTGGACGACTTCCAGTCGGGGGAGCCCGTCTACTTCTTCC
ATCCTCATTACCTGAGCAGCGTGTCGCGCTACTGGCTCAGCCTGGGCGTGCGCGCACGGCGCAT
CAGCACCGGCCTCATCCTGGTCACTGCGGCCCTGGAGCTCTGCGAGGAGGTGCACCTGTTCGGT
TTCTGGGCCTTCCCCATGAACCCCTCCGGCTTCTTCATCACGCACCACTACTATGACAATGTCA
AGCCCAAGCCCGGCTTTCATGCTATGCCCTCGGAGATCTTCACCTTCCTGCGCATGCACAGCCG
CGGCATCCTCCGCGTGCACACAGGCACCTGCAATTGCTGCTGA

hide sequence

RefSeq Acc Id:

XM_039097011 ⟹ XP_038952939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,011,856 - 73,072,984 (+)	NCBI
mRatBN7.2	18	70,736,632 - 70,800,277 (+)	NCBI

RefSeq Acc Id:

XM_039097012 ⟹ XP_038952940

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,010,235 - 73,072,984 (+)	NCBI
mRatBN7.2	18	70,736,636 - 70,800,277 (+)	NCBI

RefSeq Acc Id:

XM_039097013 ⟹ XP_038952941

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,038,219 - 73,072,984 (+)	NCBI
mRatBN7.2	18	70,757,715 - 70,802,537 (+)	NCBI

RefSeq Acc Id:

XM_039097015 ⟹ XP_038952943

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,038,223 - 73,072,984 (+)	NCBI
mRatBN7.2	18	70,757,716 - 70,802,537 (+)	NCBI

RefSeq Acc Id:

XM_063277495 ⟹ XP_063133565

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,032,885 - 73,072,984 (+)	NCBI

RefSeq Acc Id:

XM_063277496 ⟹ XP_063133566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,032,888 - 73,072,984 (+)	NCBI

RefSeq Acc Id:

XM_063277497 ⟹ XP_063133567

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,032,888 - 73,072,984 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001400037	(Get FASTA)	NCBI Sequence Viewer
	NP_998793	(Get FASTA)	NCBI Sequence Viewer
	XP_038952939	(Get FASTA)	NCBI Sequence Viewer
	XP_038952940	(Get FASTA)	NCBI Sequence Viewer
	XP_038952941	(Get FASTA)	NCBI Sequence Viewer
	XP_038952943	(Get FASTA)	NCBI Sequence Viewer
	XP_063133565	(Get FASTA)	NCBI Sequence Viewer
	XP_063133566	(Get FASTA)	NCBI Sequence Viewer
	XP_063133567	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAG27884	(Get FASTA)	NCBI Sequence Viewer
	EDL84713	(Get FASTA)	NCBI Sequence Viewer
	EDL84714	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000033363
	ENSRNOP00000033363.1
	ENSRNOP00000069340
	ENSRNOP00000069340.1
	ENSRNOP00000107226
GenBank Protein	Q6ZXC8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_998793 ⟸ NM_213628
- Peptide Label:	isoform 2
- UniProtKB:	Q6ZXC8 (UniProtKB/Swiss-Prot), A0A0G2JV41 (UniProtKB/Swiss-Prot), E9PU47 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MRYADPSANRDLLGNRTLLFIFICAFALVTLLQQILYSKSYIKRYFEFYKEPLEFNSTRCLELR QEILEVKVLSMVKQSELFERWKSLQICKWAMDASEASLFKSTLSRCCNAPNFLFTTQKNTPVET NLRYEVESSGLYHIDQEIFKMFPKEMPYYRSQFKKCAVVGNGGILKNSGCGKEINSADFVFRCN LPPISGIYTTDVGEKTDVVTVNPSIIIDRFHKLEKWRRPFFSVLQRYENASVLLPAFYNVRNTL VSFRVKYMLDDFQSGEPVYFFHPHYLSSVSRYWLSLGVRARRISTGLILVTAALELCEEVHLFG FWAFPMNPSGFFITHHYYDNVKPKPGFHAMPSEIFTFLRMHSRGILRVHTGTCNCC hide sequence

Ensembl Acc Id:

ENSRNOP00000069340 ⟸ ENSRNOT00000077679

Ensembl Acc Id:

ENSRNOP00000033363 ⟸ ENSRNOT00000035317

RefSeq Acc Id:	XP_038952939 ⟸ XM_039097011
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038952940 ⟸ XM_039097012
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038952941 ⟸ XM_039097013
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038952943 ⟸ XM_039097015
- Peptide Label:	isoform X5

RefSeq Acc Id:	NP_001400037 ⟸ NM_001413108
- Peptide Label:	isoform 1

RefSeq Acc Id:	XP_063133565 ⟸ XM_063277495
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063133566 ⟸ XM_063277496
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063133567 ⟸ XM_063277497
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000107226 ⟸ ENSRNOT00000165782

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6ZXC8-F1-model_v2	AlphaFold	Q6ZXC8	1-376	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1302934	AgrOrtholog
BioCyc Gene	G2FUF-6944	BioCyc
Ensembl Genes	ENSRNOG00000022691	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000035317	ENTREZGENE
	ENSRNOT00000035317.2	UniProtKB/Swiss-Prot
	ENSRNOT00000077679	ENTREZGENE
	ENSRNOT00000077679.2	UniProtKB/Swiss-Prot
	ENSRNOT00000165782	ENTREZGENE
Gene3D-CATH	3.90.1480.20	UniProtKB/Swiss-Prot
InterPro	Glyco_trans_29	UniProtKB/Swiss-Prot
	Glycosyltr_29_Sialyltrsf	UniProtKB/Swiss-Prot
	GT29-like_sf	UniProtKB/Swiss-Prot
	Sialyl_trans	UniProtKB/Swiss-Prot
KEGG Report	rno:364901	UniProtKB/Swiss-Prot
NCBI Gene	364901	ENTREZGENE
PANTHER	ALPHA-2,8-SIALYLTRANSFERASE	UniProtKB/Swiss-Prot
	ALPHA-2,8-SIALYLTRANSFERASE 8E	UniProtKB/Swiss-Prot
Pfam	Glyco_transf_29	UniProtKB/Swiss-Prot
PhenoGen	St8sia5	PhenoGen
PIRSF	Sialyl_trans	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000022691	RatGTEx
UniProt	A0A0G2JV41	ENTREZGENE
	A0ABK0LQH1_RAT	UniProtKB/TrEMBL
	A6KMU7_RAT	UniProtKB/TrEMBL
	A6KMU9_RAT	UniProtKB/TrEMBL
	E9PU47	ENTREZGENE
	Q6ZXC8	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	A0A0G2JV41	UniProtKB/Swiss-Prot
	E9PU47	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-05	St8sia5	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5	St8sia5	ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-15	St8sia5	ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 5	St8sia5	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	St8sia5	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5	SIAT8E	alpha-2,8-sialyltransferase	Symbol and Name updated	1299863	APPROVED
2005-02-14	SIAT8E	alpha-2,8-sialyltransferase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)