Sdhc (succinate dehydrogenase complex subunit C)

Gene: Sdhc (succinate dehydrogenase complex subunit C) Rattus norvegicus

Analyze

Symbol:

Sdhc

Name:

succinate dehydrogenase complex subunit C

RGD ID:

1359454

Description:

Predicted to enable heme binding activity. Predicted to be involved in mitochondrial electron transport, succinate to ubiquinone. Predicted to be located in mitochondrial inner membrane. Predicted to be part of mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone). Human ortholog(s) of this gene implicated in Carney-Stratakis syndrome; gastrointestinal stromal tumor; lung non-small cell carcinoma; and paraganglioma. Orthologous to human SDHC (succinate dehydrogenase complex subunit C); PARTICIPATES IN citric acid cycle pathway; electron transport chain pathway; fumaric aciduria pathway; INTERACTS WITH 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole; 6-propyl-2-thiouracil; amiodarone.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC95158; succinate dehydrogenase complex, subunit C; succinate dehydrogenase complex, subunit C, integral membrane protein; succinate dehydrogenase cytochrome b560 subunit, mitochondrial

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SDHC (succinate dehydrogenase complex subunit C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sdhc (succinate dehydrogenase complex, subunit C, integral membrane protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sdhc (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SDHC (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SDHC (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sdhc (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SDHC (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SDHC (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sdhc (succinate dehydrogenase complex subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SDHC (succinate dehydrogenase complex subunit C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sdhc (succinate dehydrogenase complex, subunit C, integral membrane protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sdhc (succinate dehydrogenase complex, subunit C, integral membrane protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mev-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6629	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SDH3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SHH3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SdhC	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sdhc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,077,133 - 86,098,025 (-)	NCBI		GRCr8
mRatBN7.2	13	83,544,652 - 83,565,560 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,544,652 - 83,566,253 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,050,394 - 86,071,277 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,448,631 - 87,469,514 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,680,351 - 84,701,243 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,498,047 - 89,518,979 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,498,048 - 89,518,939 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,125,548 - 94,146,440 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,014,569 - 87,035,239 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	87,203,453 - 87,224,123 (-)	NCBI
Celera	13	83,176,204 - 83,197,047 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune interstitial lung, joint, and kidney disease (ISO)

breast cancer (ISO)

Carney Triad (ISO)

Carney-Stratakis syndrome (ISO)

Charcot-Marie-Tooth disease (ISO)

Charcot-Marie-Tooth disease dominant intermediate D (ISO)

Charcot-Marie-Tooth disease intermediate type (ISO)

Charcot-Marie-Tooth disease type 1 (ISO)

Charcot-Marie-Tooth disease type 1B (ISO)

Charcot-Marie-Tooth disease type 2I (ISO)

Charcot-Marie-Tooth disease type 4E (ISO)

gastrointestinal stromal tumor (ISO)

Hereditary Neoplastic Syndromes (ISO)

Hereditary Paraganglioma-Pheochromocytoma Syndromes (ISO)

Islet Cell Tumor Syndrome (ISO)

Leigh disease (ISS)

lung non-small cell carcinoma (ISO)

neuroblastoma (ISO)

ovarian cancer (ISO)

paraganglioma (ISO)

Paragangliomas 3 (ISO)

parathyroid carcinoma (ISO)

pheochromocytoma (ISO)

rhabdomyosarcoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methylcholine (ISO)

4-chlorobiphenyl (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

atrazine (EXP,ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

cadmium atom (ISO)

cannabidiol (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (EXP,ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dichloromethane (ISO)

doxorubicin (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glyphosate (EXP)

indometacin (EXP)

isotretinoin (ISO)

ivermectin (ISO)

L-ethionine (EXP)

lead(0) (ISO)

mancozeb (ISO)

melittin (ISO)

methidathion (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

nimesulide (EXP)

omeprazole (EXP)

ozone (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (EXP)

quercetin (ISO)

rac-1,2-dichloropropane (ISO)

silicon dioxide (ISO)

thalidomide (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

toluene (EXP)

trichloroethene (EXP,ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

mitochondrial electron transport, succinate to ubiquinone (IBA,NAS)

proton motive force-driven mitochondrial ATP synthesis (NAS)

tricarboxylic acid cycle (IEA,NAS)

Cellular Component

mitochondrial inner membrane (ISO,NAS)

mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) (IBA,ISO,NAS)

mitochondrion (ISO)

plasma membrane (IEA)

succinate dehydrogenase complex (ubiquinone) (ISO)

Molecular Function

electron transfer activity (IEA)

heme binding (ISO)

metal ion binding (IEA)

oxidoreductase activity, acting on the CH-CH group of donors (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

citric acid cycle pathway (IEA,ISO)

electron transport chain pathway (ISO)

fumaric aciduria pathway (ISO)

Huntington's disease pathway (IEA)

mitochondrial complex II deficiency pathway (ISO)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

pyruvate dehydrogenase E2 deficiency pathway (ISO)

pyruvate dehydrogenase E3 deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Succinate dehydrogenase deficiency in human.	Briere JJ, etal., Cell Mol Life Sci. 2005 Oct;62(19-20):2317-24.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Genetic variants in genes of tricarboxylic acid cycle key enzymes are associated with prognosis of patients with non-small cell lung cancer.	Guo X, etal., Lung Cancer. 2015 Feb;87(2):162-8. doi: 10.1016/j.lungcan.2014.12.005. Epub 2014 Dec 18.
5.	Cytochrome b in human complex II (succinate-ubiquinone oxidoreductase): cDNA cloning of the components in liver mitochondria and chromosome assignment of the genes for the large (SDHC) and small (SDHD) subunits to 1q21 and 11q23.	Hirawake H, etal., Cytogenet Cell Genet 1997;79(1-2):132-8.
6.	A mutation in the SDHC gene of complex II increases oxidative stress, resulting in apoptosis and tumorigenesis.	Ishii T, etal., Cancer Res 2005 Jan 1;65(1):203-9.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Mutations in SDHC cause autosomal dominant paraganglioma, type 3.	Niemann S and Muller U, Nat Genet. 2000 Nov;26(3):268-70.
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Assembly of mammalian oxidative phosphorylation complexes I-V and supercomplexes.	Signes A and Fernandez-Vizarra E, Essays Biochem. 2018 Jul 20;62(3):255-270. doi: 10.1042/EBC20170098. Print 2018 Jul 20.
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14651853	PMID:15989954	PMID:16120479	PMID:17480203	PMID:18614015	PMID:19808025

Genomics

Comparative Map Data

Sdhc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,077,133 - 86,098,025 (-)	NCBI		GRCr8
mRatBN7.2	13	83,544,652 - 83,565,560 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,544,652 - 83,566,253 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,050,394 - 86,071,277 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,448,631 - 87,469,514 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,680,351 - 84,701,243 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,498,047 - 89,518,979 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,498,048 - 89,518,939 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,125,548 - 94,146,440 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,014,569 - 87,035,239 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	87,203,453 - 87,224,123 (-)	NCBI
Celera	13	83,176,204 - 83,197,047 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

SDHC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	161,314,381 - 161,363,206 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	161,314,381 - 161,363,206 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	161,284,171 - 161,345,130 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	159,550,790 - 159,601,165 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	158,097,242 - 158,146,049	NCBI
Celera	1	134,351,304 - 134,401,671 (+)	NCBI		Celera
Cytogenetic Map	1	q23.3	NCBI
HuRef	1	132,641,002 - 132,691,319 (+)	NCBI		HuRef
CHM1_1	1	162,680,387 - 162,730,796 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	160,451,814 - 160,500,650 (+)	NCBI		T2T-CHM13v2.0

Sdhc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	170,956,726 - 170,978,209 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	170,954,734 - 170,978,172 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	171,129,157 - 171,150,640 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	171,127,165 - 171,150,603 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	173,059,288 - 173,080,734 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	172,965,840 - 172,987,277 (-)	NCBI		MGSCv36	mm8
Celera	1	173,578,731 - 173,598,849 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	78.99	NCBI

Sdhc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	13,049,848 - 13,083,156 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	13,050,359 - 13,083,932 (+)	NCBI	ChiLan1.0	ChiLan1.0

SDHC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	88,491,404 - 88,542,144 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	88,181,669 - 88,232,415 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	136,724,663 - 136,773,038 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	140,635,250 - 140,683,390 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	140,635,685 - 140,682,736 (+)	Ensembl	panpan1.1		panPan2

SDHC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	21,162,850 - 21,200,429 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	21,162,421 - 21,200,333 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	21,237,330 - 21,275,269 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	21,280,197 - 21,318,198 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	21,275,939 - 21,318,141 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	21,177,285 - 21,215,371 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	21,583,510 - 21,621,477 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	21,991,569 - 22,029,750 (-)	NCBI		UU_Cfam_GSD_1.0

Sdhc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	7,383,971 - 7,428,187 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936903	601,355 - 636,092 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936903	592,641 - 636,845 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SDHC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	89,130,379 - 89,169,118 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	89,135,410 - 89,169,164 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	96,992,639 - 97,026,545 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SDHC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	2,613,618 - 2,658,374 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	1,670,467 - 1,715,438 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sdhc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	54,143 - 98,292 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	55,907 - 97,991 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sdhc
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	99
Count of miRNA genes:	80
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000004228
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat

Markers in Region

AA900320

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,544,834 - 83,545,029 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,498,230 - 89,498,424	NCBI	Rnor6.0
Rnor_5.0	13	94,125,731 - 94,125,925	UniSTS	Rnor5.0
RGSC_v3.4	13	87,014,752 - 87,014,946	UniSTS	RGSC3.4
Celera	13	83,176,387 - 83,176,581	UniSTS
RH 3.4 Map	13	567.6	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001005534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000004228 ⟹ ENSRNOP00000004228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,544,652 - 83,566,253 (-)	Ensembl
Rnor_6.0 Ensembl	13	89,498,048 - 89,518,939 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110173 ⟹ ENSRNOP00000083218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,544,652 - 83,566,253 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117201 ⟹ ENSRNOP00000077353

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,544,655 - 83,561,127 (-)	Ensembl

RefSeq Acc Id:

NM_001005534 ⟹ NP_001005534

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,077,133 - 86,098,025 (-)	NCBI
mRatBN7.2	13	83,544,652 - 83,565,546 (-)	NCBI
Rnor_6.0	13	89,498,047 - 89,518,939 (-)	NCBI
Rnor_5.0	13	94,125,548 - 94,146,440 (-)	NCBI
RGSC_v3.4	13	87,014,569 - 87,035,239 (-)	RGD
Celera	13	83,176,204 - 83,197,047 (-)	RGD

Sequence:

show sequence

CTCAAGATGGCTGCGCTCTTGCTGAGACACATCGGCCGCCATTGCCTCCGAGCCCACCTTAGTT
CTCAGCTCTGTATCAGAAATGCTGCTCCTTTGGGAACCACAGCTAAGGAAGAAATGGCACGGTT
CTGGAATAAGAACACGAGTTCCAACCGTCCTGTCTCTCCCCATTTGACTATCTACAGGTGGTCT
CTTCCCATGGCAATGTCTGTTTGCCACCGAGGCTCTGGGATAGCCATGAGTGGAGGGGTCTCTC
TTTTTGGCCTGTCGGCACTGCTGCTTCCTGGGAACTTTGAGTCGTATCTGATGCTTGTGAAGTC
CCTGTGTTTGGGGCCAGCGCTGATCCATGCAGCCAAGTTCGTGCTTGTCTTTCCTCTCATGTAC
CACTCATTGAATGGGGTCCGACACTTGATGTGGGACCTAGGGAAAGGCCTGTCGATTTCCCAGG
TCCAGTTGTCTGGAGTGACGGTCTTGGTTCTTGCAGTGCTGTCCTCTGCAGGACTGGCAGCCAT
ATGAAGAGCTGGGATTCCCACATCCGTCCTGTGCATCATCACACTGATCTCTATTCCTGTTTGT
CACTCCTCCCTCCAGCCACCAAGGTTCTCCTGATTTGTTTAGATGTCATGTGCTTCCGATCCCC
TGGGGGCACAGTAGAGAAGCTTACAGAACTGTAATAGTAGAAAGAATCCTTTTCCCTAGGCCTA
GGAGCCCTCATTCCTCTCCACTTTTGACTCTGATTTGTGCTGAGGGTCAGCTTTGTGCTGCTTC
TTGCTGAGACAGTGGAAACAATGCCAGTTCTGTGGCTGCCCTGAGTGCCACTGCCTGTGGGCTG
CAGGCTTAAAGGACACTTCTGTTCATTGGTCAGCTCAGGGCCTTTAGCACCCACACAGCGTGAC
TGAGAGAAGAGAAATGGAGGTGGAGGGGATCATCCTGCCCAGCTAGAGGGAGATAAAGAGCAGC
GTGGATCTTGGGAGCTCATGCTTGGGGGAAAGACAGACAGCTTTCCATGTATGAGGAAGATCAA
AAAAAAATTGTATTAAGATTGTTTCATTTTTCATTTCTAGGAACATACACCTTTAATGTCATTT
TTTCTAATCTAAATTCATGTACCATCTTTCTTTGGAAATGATTAAAGTACTACTCATTTTAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063272122 ⟹ XP_063128192

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,077,133 - 86,095,138 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001005534	(Get FASTA)	NCBI Sequence Viewer
	XP_063128192	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82027	(Get FASTA)	NCBI Sequence Viewer
	EDL94594	(Get FASTA)	NCBI Sequence Viewer
	EDL94595	(Get FASTA)	NCBI Sequence Viewer
	EDL94596	(Get FASTA)	NCBI Sequence Viewer
	EDL94597	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004228
	ENSRNOP00000004228.5
	ENSRNOP00000077353.1
	ENSRNOP00000083218.1

RefSeq Acc Id:	NP_001005534 ⟸ NM_001005534
- UniProtKB:	Q641Z9 (UniProtKB/TrEMBL), F7FI92 (UniProtKB/TrEMBL), A0A8I5Y7P2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAALLLRHIGRHCLRAHLSSQLCIRNAAPLGTTAKEEMARFWNKNTSSNRPVSPHLTIYRWSLP MAMSVCHRGSGIAMSGGVSLFGLSALLLPGNFESYLMLVKSLCLGPALIHAAKFVLVFPLMYHS LNGVRHLMWDLGKGLSISQVQLSGVTVLVLAVLSSAGLAAI hide sequence

RefSeq Acc Id:

ENSRNOP00000004228 ⟸ ENSRNOT00000004228

RefSeq Acc Id:

ENSRNOP00000083218 ⟸ ENSRNOT00000110173

RefSeq Acc Id:

ENSRNOP00000077353 ⟸ ENSRNOT00000117201

RefSeq Acc Id:	XP_063128192 ⟸ XM_063272122
- Peptide Label:	isoform X1
- UniProtKB:	A6JFU1 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q641Z9-F1-model_v2	AlphaFold	Q641Z9	1-169	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698994

Promoter ID:

EPDNEW_R9518

Type:

multiple initiation site

Name:

Sdhc_1

Description:

succinate dehydrogenase complex subunit C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	89,518,958 - 89,519,018	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359454	AgrOrtholog
BioCyc Gene	G2FUF-17388	BioCyc
BioCyc Pathway	PWY-3781 [aerobic respiration I (cytochrome c)]	BioCyc
	PWY-5690 [TCA cycle II (plants and fungi)]	BioCyc
	PWY-7279 [aerobic respiration II (cytochrome c) (yeast)]	BioCyc
BioCyc Pathway Image	PWY-3781	BioCyc
	PWY-5690	BioCyc
	PWY-7279	BioCyc
Ensembl Genes	ENSRNOG00000003163	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004228	ENTREZGENE
	ENSRNOT00000004228.6	UniProtKB/TrEMBL
	ENSRNOT00000110173.1	UniProtKB/TrEMBL
	ENSRNOT00000117201.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1300.10	UniProtKB/TrEMBL
	Single helix bin	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7130052	IMAGE-MGC_LOAD
InterPro	SQR/QFR_C/D	UniProtKB/TrEMBL
	Succ_DH_cyt_bsu_CS	UniProtKB/TrEMBL
	Succ_DH_cytb556	UniProtKB/TrEMBL
	Succ_DH_Fumarate_Rdtase_TM-su	UniProtKB/TrEMBL
KEGG Report	rno:289217	UniProtKB/TrEMBL
MGC_CLONE	MGC:95158	IMAGE-MGC_LOAD
NCBI Gene	289217	ENTREZGENE
PANTHER	PTHR10978	UniProtKB/TrEMBL
	SUCCINATE DEHYDROGENASE CYTOCHROME B560 SUBUNIT, MITOCHONDRIAL	UniProtKB/TrEMBL
Pfam	Sdh_cyt	UniProtKB/TrEMBL
PhenoGen	Sdhc	PhenoGen
PIRSF	SDH_cyt_b560	UniProtKB/TrEMBL
PROSITE	SDH_CYT_1	UniProtKB/TrEMBL
	SDH_CYT_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003163	RatGTEx
Superfamily-SCOP	SSF81343	UniProtKB/TrEMBL
UniProt	A0A8I5Y7P2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZYU8_RAT	UniProtKB/TrEMBL
	A6JFT8_RAT	UniProtKB/TrEMBL
	A6JFT9_RAT	UniProtKB/TrEMBL
	A6JFU1	ENTREZGENE, UniProtKB/TrEMBL
	F7FI92	ENTREZGENE, UniProtKB/TrEMBL
	Q641Z9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-16	Sdhc	succinate dehydrogenase complex subunit C	Sdhc	succinate dehydrogenase complex, subunit C, integral membrane protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Sdhc	succinate dehydrogenase complex, subunit C, integral membrane protein		succinate dehydrogenase complex, subunit C	Name updated	1299863	APPROVED
2005-07-29	Sdhc	succinate dehydrogenase complex, subunit C			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways