Taf7 (TATA-box binding protein associated factor 7)

Gene: Taf7 (TATA-box binding protein associated factor 7) Rattus norvegicus

Analyze

Symbol:

Taf7

Name:

TATA-box binding protein associated factor 7

RGD ID:

1309935

Description:

Predicted to enable several functions, including P-TEFb complex binding activity; TFIIH-class transcription factor complex binding activity; and nuclear receptor binding activity. Predicted to contribute to H3K27me3 modified histone binding activity and RNA polymerase II general transcription initiation factor activity. Predicted to be involved in regulation of macromolecule biosynthetic process and transcription by RNA polymerase II. Predicted to act upstream of or within intracellular estrogen receptor signaling pathway and transcription by RNA polymerase II. Predicted to be located in cytoplasm and male germ cell nucleus. Predicted to be part of MLL1 complex; transcription factor TFIID complex; and transcription factor TFTC complex. Predicted to be active in nucleus. Orthologous to human TAF7 (TATA-box binding protein associated factor 7); PARTICIPATES IN RNA polymerase II transcription initiation pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC307485; TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa; transcription initiation factor TFIID subunit 7

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	29,704,182 - 29,713,382 (-)	NCBI		GRCr8
mRatBN7.2	18	29,459,937 - 29,462,086 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	29,452,943 - 29,462,134 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	29,564,287 - 29,566,435 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,326,296 - 30,328,444 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	29,661,623 - 29,663,771 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	30,779,149 - 30,781,297 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	30,779,150 - 30,781,292 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	30,475,376 - 30,477,524 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	30,541,432 - 30,543,580 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	30,568,523 - 30,569,630 (-)	NCBI
Celera	18	29,106,903 - 29,109,051 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant intellectual developmental disorder 31 (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1-fluoro-2,4-dinitrobenzene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antimycin A (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP)

caffeine (ISO)

carbamazepine (ISO)

chlormequat chloride (EXP)

chlorpyrifos (ISO)

chromium atom (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cypermethrin (ISO)

deguelin (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

disulfiram (ISO)

ethanol (ISO)

ferroheme b (ISO)

folic acid (ISO)

FR900359 (ISO)

furan (EXP)

gentamycin (EXP)

heme b (ISO)

paracetamol (EXP,ISO)

phenol (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

quercetin (ISO)

resorcinol (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

tetrachloromethane (EXP,ISO)

theophylline (ISO)

thioacetamide (EXP)

triptonide (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

DNA-templated transcription initiation (ISO)

intracellular estrogen receptor signaling pathway (ISO)

mRNA transcription by RNA polymerase II (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of MHC class I biosynthetic process (ISO)

negative regulation of MHC class II biosynthetic process (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of transcription initiation by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA,ISO)

RNA polymerase II preinitiation complex assembly (IBA,ISO)

transcription by RNA polymerase II (ISO)

transcription initiation at RNA polymerase II promoter (ISO)

Cellular Component

cytoplasm (ISO)

male germ cell nucleus (ISO)

MLL1 complex (ISO)

nucleus (ISO)

transcription factor TFIID complex (IBA,ISO)

transcription factor TFTC complex (ISO)

transcription regulator complex (ISO)

Molecular Function

DNA-binding transcription factor binding (ISO)

H3K27me3 modified histone binding (ISO)

histone acetyltransferase binding (ISO)

nuclear thyroid hormone receptor binding (ISO)

nuclear vitamin D receptor binding (ISO)

P-TEFb complex binding (ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

RNA polymerase II general transcription initiation factor activity (IBA,ISO)

TFIIH-class transcription factor complex binding (ISO)

transcription cis-regulatory region binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Structural bioinformatics of the general transcription factor TFIID.	Malkowska M, etal., Biochimie. 2013 Apr;95(4):680-91. doi: 10.1016/j.biochi.2012.10.024. Epub 2012 Nov 9.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:7824954	PMID:9603525	PMID:10409738	PMID:10438527	PMID:11005381	PMID:11592977	PMID:12477932	PMID:12665565	PMID:12676957	PMID:14580349	PMID:15960975	PMID:16407123
PMID:18391197	PMID:20937824	PMID:22323595	PMID:24927529	PMID:25412659	PMID:27007846

Genomics

Comparative Map Data

Taf7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	29,704,182 - 29,713,382 (-)	NCBI		GRCr8
mRatBN7.2	18	29,459,937 - 29,462,086 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	29,452,943 - 29,462,134 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	29,564,287 - 29,566,435 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,326,296 - 30,328,444 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	29,661,623 - 29,663,771 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	30,779,149 - 30,781,297 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	30,779,150 - 30,781,292 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	30,475,376 - 30,477,524 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	30,541,432 - 30,543,580 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	30,568,523 - 30,569,630 (-)	NCBI
Celera	18	29,106,903 - 29,109,051 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

TAF7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	141,318,490 - 141,320,784 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	141,259,884 - 141,320,784 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	140,698,057 - 140,700,351 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	140,678,241 - 140,680,535 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	140,678,241 - 140,680,535	NCBI
Celera	5	136,774,883 - 136,777,177 (-)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	135,843,117 - 135,845,411 (-)	NCBI		HuRef
CHM1_1	5	140,131,262 - 140,133,556 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	141,843,793 - 141,846,087 (-)	NCBI		T2T-CHM13v2.0

Taf7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	37,773,544 - 37,777,257 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	37,773,544 - 37,777,257 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	37,640,491 - 37,644,204 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	37,640,491 - 37,644,204 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	37,800,145 - 37,803,858 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	37,766,876 - 37,772,457 (-)	NCBI		MGSCv36	mm8
Celera	18	38,972,979 - 38,976,692 (-)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	19.54	NCBI

Taf7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	12,453,655 - 12,456,070 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	12,453,655 - 12,456,070 (+)	NCBI	ChiLan1.0	ChiLan1.0

TAF7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	136,568,526 - 136,570,950 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	134,708,078 - 134,710,551 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	136,680,554 - 136,682,862 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	142,794,156 - 142,796,442 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

TAF7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	36,295,387 - 36,297,681 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	36,295,911 - 36,296,960 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	33,347,329 - 33,349,652 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	36,749,118 - 36,751,441 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	36,749,126 - 36,751,457 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	33,824,087 - 33,826,410 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	34,635,069 - 34,637,392 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	35,442,754 - 35,445,077 (-)	NCBI		UU_Cfam_GSD_1.0

Taf7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	151,250,983 - 151,253,265 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	12,824,953 - 12,827,214 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	12,824,928 - 12,827,238 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAF7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	142,947,343 - 142,952,505 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	142,949,271 - 142,952,611 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	149,149,391 - 149,151,779 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAF7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	43,938,202 - 43,940,486 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	43,938,714 - 43,939,763 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	33,913,731 - 33,916,051 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Taf7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	548,072 - 550,404 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	548,072 - 550,410 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Taf7
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	36
Count of miRNA genes:	34
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000027125
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	38	41	26	19	26	8	9	68	30	38	11	8
Low		5	16	15		15		2	6	5	3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010059576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158715	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000027125 ⟹ ENSRNOP00000027125

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	29,453,588 - 29,462,134 (-)	Ensembl
Rnor_6.0 Ensembl	18	30,779,150 - 30,781,292 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115666 ⟹ ENSRNOP00000089967

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	29,452,943 - 29,462,134 (-)	Ensembl

RefSeq Acc Id:

NM_001107394 ⟹ NP_001100864

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	29,711,176 - 29,713,324 (-)	NCBI
mRatBN7.2	18	29,459,937 - 29,462,086 (-)	NCBI
Rnor_6.0	18	30,779,149 - 30,781,297 (-)	NCBI
Rnor_5.0	18	30,475,376 - 30,477,524 (-)	NCBI
RGSC_v3.4	18	30,541,432 - 30,543,580 (-)	RGD
Celera	18	29,106,903 - 29,109,051 (-)	RGD

Sequence:

show sequence

TTTTTTTTTTTCTGCGTGGGAGGAGGCTTGGCAAGGTCCTCTCCGGAGTTCGGATGTTTGAGCG
GCAGTGTGGCGAGGTTTCGCGCTGCGGGTCCTGAGCCGTTTCGTTGTTAGCGCTCAGGTCGCCT
TGCCGGGCGGCTGAAAGCGCGGACAAACTGGAAGGTAGACGCACCGCTCATCGCTGCTTTACTC
AGGCCGAGAAAAGCTGAGTTCATAGTTGCTGGTGAACTGAGCTGGAACTTGTTAGTGCAGCAGG
TGTTTATTGGAGAAGTAATTCACAAGGAAGTGAAGATGAGTAAGAGCAAAGATGATGCACCTCA
TGAGCTAGAGAGCCAGTTTATCTTACGGTTGCCCCCAGAATATGCCGCTACTGTGAGGAGGGCA
GTGCAGTCTGGGCACGTCAACCTGAAAGATAGACTGAGCATTGAGTTACACCCTGATGGGCGTC
ATGGGATTGTCAGAGTGGATAGAGTGCCCCTGGCTGCAAAATTGGTAGATTTGCCGTGTGTTAC
GGAGAGCTTGAAAACCATTGATAAAAAAACCTTTTACAAGACAGCTGATATCTCTCAGATGCTT
GTAGCCACAGTAGATGGTGATCTATACCCTCCTGTGGAGGAGCCAGCTGCTACTGCTGATCCCA
AAGCAAACAAGAAAAAAGATAAGGACAAAGAGAAAAAATTTGTTTGGAACCATGGAATTACTCT
ACCTCTAAAAAATGTCAGAAAGAGAAGGTTCCGGAAGACAGCAAAGAAGAAGTACATTGAATCT
CCAGATGTGGAAAAAGAAGTAAAGCGGCTGCTGAGTACAGATGCAGAAGCTGTCAGTACTCGTT
GGGAGATAATTGCTGAAGATGAAACAAAGGAGGCAGAAAATCAAGGCCTTGATATCTCCTCTCC
TGGAATGTCTGGCCACAGGCAGGGCCATGACTCACTAGAGCATGATGAGCTTCGAGAGATATTC
AATGACCTCAGCAGCAGCAGCGAAGATGAAGAAGATGTAAACATCATTGACACTGAAGAGGATC
TGGAGAGACAGCTACAGGACAAGCTAAATGAGTCAGATGAACAACACCAAGAAAATGAAGGAAC
CAATCAGTTGGTTATGGGGATTCAGAAGCAGATTGATAATATGAAAGGCAAGCTTCAAGAAACC
CAAGACAGAGCAAAGCGCCAGGAGGATCTCATCATGAAGGTAGAAAACCTGGCTCTGAAGAACA
GGTTTCAAGCTGTTCTGGATGAGCTCAAACAGAAGGAAGACCGGGAAAAGGAGCAGCTTAGCTC
TTTGCAAGAAGAGCTGGAATCACTTCTGGAGAAGTGAAAAGGTTGACTTTAGTCCTTAGACTAG
TCAGCTTAAGAAGAATTTATTTTCAGAGTGAGGTCTTGAAAAATTCTTCTTTTTTCTTTGAAAT
ATTCTTATTTCCTGTAATGCTAGGAGTTATTGTGTTGATTGTTTTCACTCTTAAGAAAATAGGA
TTACATAGGCAGATTTGTTGTAGTGTAAGGTTAGTGAAGTGACAACACTGAGCTTTTAATCACT
TCACCATAGGACTTTATTACAATTTGTTTCCTAAGTTTCTAGTCCTATTCTTCGGTGCTAAGAT
CAGTAAGAAGCTAGCTAGCCTACAGGCAATGGAGTGTTTTTTTTTTTTTTTTTGTTTTTTTTTT
AAGAAATATATTTTTTTACCTTCTCAGCAAGTTTCCATGTTACAGAAATGCAAGTTTTTTCATA
AAAGTTGTTTTTTGCACAATAAAAGTTACTAATTTTCAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

RefSeq Acc Id:

XR_010059576

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	29,704,182 - 29,713,382 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100864	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58716	(Get FASTA)	NCBI Sequence Viewer
	EDL76362	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027125.5
	ENSRNOP00000089967
	ENSRNOP00000089967.1

RefSeq Acc Id:

NP_001100864 ⟸ NM_001107394

- UniProtKB:

B0BN78 (UniProtKB/TrEMBL), A0A8I6ABH9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSKSKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDRLSIELHPDGRHGIVRVDRVPLA
AKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEPAATADPKANKKKDKDKEK
KFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEA
ENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEEDVNIIDTEEDLERQLQDKLNES
DEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQK
EDREKEQLSSLQEELESLLEK

hide sequence

RefSeq Acc Id:

ENSRNOP00000027125 ⟸ ENSRNOT00000027125

RefSeq Acc Id:

ENSRNOP00000089967 ⟸ ENSRNOT00000115666

Protein Domains

TAFII55 protein conserved region

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN78-F1-model_v2	AlphaFold	B0BN78	1-341	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700734

Promoter ID:

EPDNEW_R11258

Type:

initiation region

Name:

Taf7_1

Description:

TATA-box binding protein associated factor 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	30,781,299 - 30,781,359	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309935	AgrOrtholog
BioCyc Gene	G2FUF-7816	BioCyc
Ensembl Genes	ENSRNOG00000020024	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027125.8	UniProtKB/TrEMBL
	ENSRNOT00000115666	ENTREZGENE
	ENSRNOT00000115666.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9088638	IMAGE-MGC_LOAD
InterPro	TAF7	UniProtKB/TrEMBL
	TAFII55_prot_cons_reg	UniProtKB/TrEMBL
KEGG Report	rno:307485	UniProtKB/TrEMBL
MGC_CLONE	MGC:187853	IMAGE-MGC_LOAD
NCBI Gene	307485	ENTREZGENE
PANTHER	PTHR12228	UniProtKB/TrEMBL
	TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 7	UniProtKB/TrEMBL
Pfam	TAFII55_N	UniProtKB/TrEMBL
PhenoGen	Taf7	PhenoGen
RatGTEx	ENSRNOG00000020024	RatGTEx
SMART	TAFII55_N	UniProtKB/TrEMBL
UniProt	A0A8I6ABH9	ENTREZGENE, UniProtKB/TrEMBL
	B0BN78	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-14	Taf7	TATA-box binding protein associated factor 7	Taf7	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-04-27	Taf7	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor	Taf7	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Taf7	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa	Taf7_predicted	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Taf7_predicted	TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations