Gars1 (glycyl-tRNA synthetase 1) - Rat Genome Database

Name: Gars1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Gars1 (glycyl-tRNA synthetase 1) Rattus norvegicus

Analyze

Symbol:

Gars1

Name:

glycyl-tRNA synthetase 1

RGD ID:

1307856

Description:

Predicted to enable several functions, including bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity; glycine-tRNA ligase activity; and identical protein binding activity. Predicted to be involved in diadenosine tetraphosphate biosynthetic process and mitochondrial glycyl-tRNA aminoacylation. Predicted to act upstream of or within glycyl-tRNA aminoacylation. Predicted to be located in several cellular components, including axon; extracellular exosome; and secretory granule. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease type 2D and autosomal dominant distal hereditary motor neuronopathy 5. Orthologous to human GARS1 (glycyl-tRNA synthetase 1); PARTICIPATES IN dihydropyrimidine dehydrogenase deficiency pathway; dimethylglycine dehydrogenase deficiency pathway; nonketotic hyperglycinemia pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AP-4-A synthetase; ap4A synthetase; diadenosine tetraphosphate synthetase; Gars; glycine--tRNA ligase; glycyl-tRNA synthetase; GlyRS; LOC297113; RGD1559871

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GARS1 (glycyl-tRNA synthetase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gars1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gars1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GARS1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GARS1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gars1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GARS1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GARS1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gars1 (glycyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GARS1 (glycyl-tRNA synthetase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gars1 (glycyl-tRNA synthetase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gars (glycyl-tRNA synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GRS1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GlyRS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gars-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GRS2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gars1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	85,484,939 - 85,542,876 (+)	NCBI		GRCr8
mRatBN7.2	4	84,171,596 - 84,212,609 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	84,171,596 - 84,212,609 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	89,394,653 - 89,435,634 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	85,170,068 - 85,211,053 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	83,582,545 - 83,623,437 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	85,235,122 - 85,276,085 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	85,235,172 - 85,276,044 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	149,884,600 - 149,933,329 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	83,718,584 - 83,759,591 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	84,123,817 - 84,165,539 (-)	NCBI
Celera	4	79,038,903 - 79,079,749 (+)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant distal hereditary motor neuronopathy (ISO)

autosomal dominant distal hereditary motor neuronopathy 14 (ISO)

autosomal dominant distal hereditary motor neuronopathy 5 (ISO)

axonal neuropathy (ISO)

Charcot-Marie-Tooth disease (ISO)

Charcot-Marie-Tooth disease type 1 (ISO)

Charcot-Marie-Tooth disease type 2 (ISO)

Charcot-Marie-Tooth disease type 2D (ISO,ISS)

Ehlers-Danlos syndrome kyphoscoliotic type 2 (ISO)

genetic disease (ISO)

motor neuron disease (ISO)

pleomorphic xanthoastrocytoma (ISO)

spinal muscular atrophy (ISO)

Spinal Muscular Atrophy, Infantile, James Type (ISO)

Talipes Cavus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

allethrin (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bexarotene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bucladesine (ISO)

buspirone (EXP)

cadmium dichloride (EXP,ISO)

captan (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroacetaldehyde (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clobetasol (ISO)

clodronic acid (ISO)

clofibric acid (EXP)

copper(II) sulfate (ISO)

cyclosporin A (EXP,ISO)

cyhalothrin (EXP)

cypermethrin (EXP)

diarsenic trioxide (ISO)

diclofenac (ISO)

dioxygen (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

enzyme inhibitor (ISO)

fenofibrate (ISO)

fenthion (ISO)

fenvalerate (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

fumonisin B1 (ISO)

gefitinib (ISO)

ifosfamide (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

lamivudine (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

medroxyprogesterone acetate (ISO)

metformin (EXP)

methidathion (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

ochratoxin A (ISO)

omega-6 fatty acid (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP)

phenobarbital (EXP,ISO)

progesterone (ISO)

pyrethrins (EXP)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (EXP,ISO)

triadimefon (EXP)

trichloroethene (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

urethane (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

zearalenone (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

diadenosine tetraphosphate biosynthetic process (IEA,ISO,ISS)

glycyl-tRNA aminoacylation (IEA,ISO)

mitochondrial glycyl-tRNA aminoacylation (IBA,IEA)

tRNA aminoacylation for protein translation (ISO,ISS)

Cellular Component

axon (IEA,ISO,ISS)

cytoplasm (IBA)

cytosol (IEA,ISO)

extracellular exosome (IEA,ISO,ISS)

mitochondrion (IBA,IEA)

secretory granule (IEA,ISO)

Molecular Function

ATP binding (IEA)

bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity (IEA,ISO,ISS)

glycine-tRNA ligase activity (IBA,IEA,ISO,ISS)

identical protein binding (IEA,ISO)

protein binding (ISO)

protein dimerization activity (IEA,ISO,ISS)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

aminoacyl-tRNA biosynthetic pathway (IEA)

dihydropyrimidine dehydrogenase deficiency pathway (ISO)

dimethylglycine dehydrogenase deficiency pathway (ISO)

nonketotic hyperglycinemia pathway (ISO)

sarcosinemia pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8939962	PMID:12477932	PMID:16854843	PMID:17035524	PMID:17544401	PMID:17545306	PMID:17595294	PMID:18614015	PMID:19470612	PMID:19710017	PMID:22082260	PMID:22871113
PMID:23376485	PMID:24625528	PMID:26503042	PMID:28675565	PMID:30053369

Genomics

Comparative Map Data

Gars1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	85,484,939 - 85,542,876 (+)	NCBI		GRCr8
mRatBN7.2	4	84,171,596 - 84,212,609 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	84,171,596 - 84,212,609 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	89,394,653 - 89,435,634 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	85,170,068 - 85,211,053 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	83,582,545 - 83,623,437 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	85,235,122 - 85,276,085 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	85,235,172 - 85,276,044 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	149,884,600 - 149,933,329 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	83,718,584 - 83,759,591 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	84,123,817 - 84,165,539 (-)	NCBI
Celera	4	79,038,903 - 79,079,749 (+)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

GARS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	30,594,735 - 30,634,033 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	30,580,533 - 30,634,033 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	30,634,351 - 30,673,649 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	30,600,706 - 30,640,174 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	30,407,420 - 30,446,884	NCBI
Celera	7	30,623,360 - 30,662,827 (+)	NCBI		Celera
Cytogenetic Map	7	p14.3	NCBI
HuRef	7	30,516,030 - 30,555,489 (+)	NCBI		HuRef
CHM1_1	7	30,634,438 - 30,673,905 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	30,732,340 - 30,771,637 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	30,683,834 - 30,723,301 (+)	NCBI

Gars1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	55,014,986 - 55,056,489 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	55,014,992 - 55,056,485 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	55,038,001 - 55,079,504 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	55,038,007 - 55,079,500 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	54,987,995 - 55,029,498 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	54,967,598 - 55,009,078 (+)	NCBI		MGSCv36	mm8
Celera	6	55,573,683 - 55,614,743 (+)	NCBI		Celera
Cytogenetic Map	6	B3	NCBI
cM Map	6	27.29	NCBI

Gars1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	31,779,543 - 31,819,113 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955410	31,778,654 - 31,819,287 (+)	NCBI	ChiLan1.0	ChiLan1.0

GARS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	35,406,501 - 35,445,814 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	83,731,131 - 83,770,542 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	31,208,351 - 31,247,841 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	31,329,572 - 31,368,719 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	31,329,456 - 31,368,582 (+)	Ensembl	panpan1.1		panPan2

GARS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	43,308,274 - 43,351,999 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	43,308,152 - 43,396,487 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	42,741,012 - 42,784,674 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	43,249,452 - 43,293,125 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	43,249,308 - 43,295,729 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	43,365,329 - 43,408,974 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	43,041,322 - 43,084,982 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	43,402,683 - 43,446,352 (+)	NCBI		UU_Cfam_GSD_1.0

Gars1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	87,636,717 - 87,677,496 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	6,848,322 - 6,889,045 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	6,848,448 - 6,889,103 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GARS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	42,311,576 - 42,352,162 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	42,311,711 - 42,352,201 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	46,675,442 - 46,768,505 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GARS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	27,750,532 - 27,791,143 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	27,749,514 - 27,790,881 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	76,909,963 - 76,953,465 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gars1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	171,777 - 211,164 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624739	172,111 - 211,229 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gars1
156 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	27
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000014780
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78885890	102684881	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
2306794	Ean2	Experimental allergic neuritis QTL 2	6.4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	4	83428419	95853334	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat

Markers in Region

RH133826

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	84,210,880 - 84,212,302 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	85,274,357 - 85,275,778	NCBI	Rnor6.0
Rnor_5.0	4	149,931,601 - 149,933,022	UniSTS	Rnor5.0
RGSC_v3.4	4	83,718,891 - 83,720,312	UniSTS	RGSC3.4
Celera	4	79,078,021 - 79,079,442	UniSTS
RH 3.4 Map	4	523.2	UniSTS
Cytogenetic Map	4	q24	UniSTS

RH142694

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	84,177,684 - 84,177,785 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	34,201,033 - 34,201,134 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	33,165,333 - 33,165,433	NCBI	Rnor6.0
Rnor_6.0	4	85,241,212 - 85,241,312	NCBI	Rnor6.0
Rnor_5.0	2	52,301,473 - 52,301,573	UniSTS	Rnor5.0
Rnor_5.0	4	149,898,456 - 149,898,556	UniSTS	Rnor5.0
Celera	4	79,044,993 - 79,045,093	UniSTS
Celera	2	30,185,400 - 30,185,500	UniSTS
RH 3.4 Map	1	819.5	UniSTS
Cytogenetic Map	2	q12	UniSTS
Cytogenetic Map	4	q24	UniSTS

BM384835

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	84,204,987 - 84,205,197 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	85,268,465 - 85,268,674	NCBI	Rnor6.0
Rnor_5.0	4	149,925,709 - 149,925,918	UniSTS	Rnor5.0
RGSC_v3.4	4	83,725,995 - 83,726,204	UniSTS	RGSC3.4
Celera	4	79,072,157 - 79,072,366	UniSTS
RH 3.4 Map	4	522.3	UniSTS
Cytogenetic Map	4	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063285772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014780 ⟹ ENSRNOP00000014780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	84,171,596 - 84,212,609 (+)	Ensembl
Rnor_6.0 Ensembl	4	85,235,172 - 85,276,044 (+)	Ensembl

RefSeq Acc Id:

NM_001271139 ⟹ NP_001258068

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,501,865 - 85,542,876 (+)	NCBI
mRatBN7.2	4	84,171,596 - 84,212,609 (+)	NCBI
Rnor_6.0	4	85,235,122 - 85,276,085 (+)	NCBI
Rnor_5.0	4	149,884,600 - 149,933,329 (+)	NCBI
Celera	4	79,038,903 - 79,079,749 (+)	NCBI

Sequence:

show sequence

TTTCATCATGCACCGGGCGGGCCGCGCGCCGCTTCCGTAGCCGCCCTGCGCACCGCCTAGGCGG
CGTGCTCATGCCCTGTCTGCTCCCCACGCTGCTCAGAGCCACCCGCGCCGCGCTGCTCCTACAG
TCGCCCCGAGTGGTCGCAGCGCCCGCGTCTCAGCGGCTCCTCAGCGCTCCCGCGCAGCCCGCCG
CCTCTCCGAGCAGCATGGACAGCGCCGAGGAGCTGCTAGCCCCATTGCGGCTAGCTGTGCGCCA
GCAGGGAGACTTTGTACGGAAGTTAAAAGAAGATAAAGCCCCACAAGTGGATGTGGACAGAGCA
GTAGCTGAGCTCAAGGCCCGGAAGAGGGTTCTGGAAGCAAAGGAGCTGGCGTTGCAGCCCAAAG
ATGACATCGTAGATAGAGCAAAAATGGAGGATACTTTGAAGAGGAGATTTTTCTACGATCAAGC
TTTTGCTATTTATGGAGGTGTCAGTGGTTTGTATGACTTTGGGCCAGTGGGATGTGCTTTGAAG
AACAATATCATCCAGACCTGGAGGCAGCACTTTATCCAAGAGGAACAGATCCTGGAAATTGACT
GCACCATGCTCACCCCCGAGCCAGTTTTAAAGACCTCTGGCCATGTAGACAAATTTGCTGACTT
CATGGTGAAGGACGTGAAGAACGGAGAGTGCTTCCGCGCGGACCACCTGTTGAAAGCTCATTTA
CAGAAACTGATGTCAGATAAGAAGTGCTCTGCTGAGAAGAAATCAGAGATGGAAAGTGTCTTGG
CCCAGCTTGATAACTATGGACAACAAGAACTGGCGGATCTTTTTGTGAACTATAATGTAAAATC
TCCCACCACTGGCAATGACCTGTCCCCTCCGGTACCTTTTAACTTAATGTTCCAGACCTTCATT
GGGCCTGGAGGAAACATGCCTGGATATCTGAGACCAGAAACTGCACAGGGAATTTTCCTAAATT
TCAAACGACTTTTGGAATTCAACCAAGGGAAGTTGCCTTTTGCTGCTGCACAGATTGGAAACTC
CTTTAGAAATGAGATCTCGCCCCGGTCTGGACTGATCCGAGTCAGGGAATTCACAATGGCAGAG
ATCGAGCACTTTGTAGATCCCACTGAGAAAGACCATCCCAAGTTCCCGAGCGTGGCCGACCTCT
ACCTTTATTTGTACTCTGCCAAAGCCCAGGTCACTGGACAGTCTGCTCGCAAGATGCGTCTGGG
AGATGCTGTTGAACAGGGTGTGATTAACAACTCAGTATTAGGCTATTTTATTGGCCGCATCTAC
CTCTACCTCACGAAGGTTGGAATATCTCCTGATAAACTCCGCTTCCGACAGCATATGGAGAATG
AGATGGCCCATTATGCCTGCGACTGCTGGGATGCTGAGTCCAAAACGTCCTATGGCTGGATCGA
GATTGTTGGATGTGCTGACCGATCCTGCTATGACCTCTCCTGTCATGCTCGAGCCACCAAAGTC
CCGCTGGTGGCTGAGAAGCCCCTGAAAGAGCCCAAAACAGTTAACGTTGTACAGTTTGAGCCCA
ACAAGGGAGCCGTGGGCAAGGCGTACAAGAAAGATGCAAAGCTGGTGCTGGAGTACCTCGGCGC
CTGCGATGAGTGCTACATTACCGAGATGGAGCTGCTGCTGAGCGAGAAAGGGGAATTCACTATT
GAAACTGAAGGAAAAACATTTCAGTTAACAAAAGACATGGTCAGTGTGAAGAGATTCCAGAAAA
CACTACACGTGGAAGAAGTTGTTCCGAGTGTAATTGAGCCCTCTTTTGGCCTGGGCAGGATCAT
GTATACCATATTGGAACATACATTCCACGTCCGGGAGGGAGATGAGCAGAGAACGTTCTTCAGT
TTCCCTGCTGTGGTTGCTCCATTCAAATGTTCTGTCCTTCCACTGAGCCAAAACCAAGAGTTTA
TGCCATTTGTCAAGGAATTATCGGAAGCTCTGACTCGAAATGGCGTGTCTCATAAAGTTGACGA
TTCCTCTGGGTCTATTGGAAGGCGCTATGCAAGAACTGATGAGATTGGCGTGGCGTTTGGCATC
ACCATTGACTTTGATACAGTGAACAAGACCCCCCACACTGCAACTCTGAGGGACCGAGACTCCA
TGAGACAGATAAGGGCAGAGGTCTCTGAACTGCCCAGTGTGGTCCGTGATCTGGCCAATGGCAA
CATCACTTGGGCTGATGTGGAGGCCAGGTACCCCCTCTTTGAAGGGCAAGAGACTGGCAAGAAG
GAGACAGTGGAAGAATGAGAACAGCTGGCGACTTGTGACAACCTGTGCTAATAAATAACTCATC
GTGTCCACTACACAAACGTTTCGACTGCTTCCAGGGACTATTTTTCCTCAGTGGCTGCTTGATT
TTACCCCCACAATTAAAGTTGAAGGAATTCTGAACAAATTTACAATCCATCTGTTGTTTTTCCA
TTTTTTAACAAAGACATTTCTCTCAGA

hide sequence

RefSeq Acc Id:

XM_063285771 ⟹ XP_063141841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,501,864 - 85,542,823 (+)	NCBI

RefSeq Acc Id:

XM_063285772 ⟹ XP_063141842

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	85,484,939 - 85,542,823 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001258068	(Get FASTA)	NCBI Sequence Viewer
	XP_063141841	(Get FASTA)	NCBI Sequence Viewer
	XP_063141842	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88347	(Get FASTA)	NCBI Sequence Viewer
	EDL88100	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014780
	ENSRNOP00000014780.6
GenBank Protein	Q5I0G4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001258068 ⟸ NM_001271139

- UniProtKB:

Q5I0G4 (UniProtKB/Swiss-Prot), G3V7G8 (UniProtKB/TrEMBL), A0A8L2Q7W8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPCLLPTLLRATRAALLLQSPRVVAAPASQRLLSAPAQPAASPSSMDSAEELLAPLRLAVRQQG
DFVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFA
IYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMV
KDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPT
TGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFR
NEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFPSVADLYLYLYSAKAQVTGQSARKMRLGDA
VEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIV
GCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLGACD
ECYITEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYT
ILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSS
GSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRDLANGNIT
WADVEARYPLFEGQETGKKETVEE

hide sequence

RefSeq Acc Id:

ENSRNOP00000014780 ⟸ ENSRNOT00000014780

RefSeq Acc Id:	XP_063141842 ⟸ XM_063285772
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063141841 ⟸ XM_063285771
- Peptide Label:	isoform X1

Protein Domains

Aminoacyl-transfer RNA synthetases class-II family WHEP-TRS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0G4-F1-model_v2	AlphaFold	Q5I0G4	1-728	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693072

Promoter ID:

EPDNEW_R3596

Type:

initiation region

Name:

Gars_1

Description:

glycyl-tRNA synthetase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	85,235,220 - 85,235,280	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307856	AgrOrtholog
BioCyc Gene	G2FUF-44743	BioCyc
BioCyc Pathway	TRNA-CHARGING-PWY [tRNA charging]	BioCyc
BioCyc Pathway Image	TRNA-CHARGING-PWY	BioCyc
Ensembl Genes	ENSRNOG00000011052	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014780	ENTREZGENE
	ENSRNOT00000014780.7	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.230	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.30.720.200	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.800	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S15/NS1, RNA-binding	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7368341	IMAGE-MGC_LOAD
InterPro	aa-tRNA-synt_IIb	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	aa-tRNA-synth_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	aa-tRNA-synth_II/BPL/LPL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Anticodon-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Anticodon-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Gly-tRNA_synthase/POLG2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GlyRS-like_core	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S15_NS1_RNA-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	tRNA-synt_gly	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WHEP-TRS_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:297113	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109655	IMAGE-MGC_LOAD
NCBI Gene	297113	ENTREZGENE
PANTHER	GLYCINE--TRNA LIGASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10745	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HGTP_anticodon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	tRNA-synt_2b	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WHEP-TRS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gars1	PhenoGen
PRINTS	TRNASYNTHGLY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	AA_TRNA_LIGASE_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WHEP_TRS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WHEP_TRS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011052	RatGTEx
SMART	WHEP-TRS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Class II aaRS ABD-related	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47060	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF55681	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q7W8	ENTREZGENE, UniProtKB/TrEMBL
	G3V7G8	ENTREZGENE
	GARS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	G3V7G8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-10-14	Gars1	glycyl-tRNA synthetase 1	Gars	glycyl-tRNA synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gars	glycyl-tRNA synthetase	Gars_predicted	glycyl-tRNA synthetase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gars_predicted	glycyl-tRNA synthetase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways