Advanced Search (OLGA)

Gene: Gpr135 (G protein-coupled receptor 135) Rattus norvegicus

Analyze

Symbol:

Gpr135

Name:

G protein-coupled receptor 135

RGD ID:

727844

Description:

Predicted to enable G protein-coupled receptor activity and arrestin family protein binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in endosome and plasma membrane. Orthologous to human GPR135 (G protein-coupled receptor 135); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G-protein coupled receptor 135; probable G-protein coupled receptor 135

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR135 (G protein-coupled receptor 135)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gpr135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpr135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gpr135 (G protein-coupled receptor 135)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GPR135 (G protein-coupled receptor 135)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr135 (G protein-coupled receptor 135)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr135	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr135	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	96,363,466 - 96,366,594 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	96,362,867 - 96,382,988 (-)	Ensembl				GRCr8
mRatBN7.2	6	90,627,533 - 90,630,661 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	90,629,178 - 90,630,551 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	90,999,916 - 91,001,289 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	91,299,380 - 91,300,753 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	90,738,936 - 90,740,309 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	94,816,976 - 94,818,349 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	94,816,976 - 94,818,349 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	104,261,635 - 104,263,008 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	94,262,988 - 94,264,361 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	89,094,054 - 89,095,427 (-)	NCBI		Celera
RGSC_v3.1	6	94,266,443 - 94,267,817 (-)	NCBI
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

lung non-small cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

asbestos (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cannabidiol (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

diquat (ISO)

endosulfan (EXP)

ethanol (ISO)

folic acid (ISO)

genistein (ISO)

indometacin (ISO)

levonorgestrel (ISO)

N-Nitrosopyrrolidine (ISO)

okadaic acid (ISO)

ozone (ISO)

PhIP (ISO)

silicon dioxide (ISO)

sulforaphane (ISO)

testosterone undecanoate (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IBA,IEA)

signal transduction (IEA)

Cellular Component

endosome (ISO)

endosome membrane (IEA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

arrestin family protein binding (ISO)

G protein-coupled receptor activity (IBA,IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.	Fredriksson R, etal., FEBS Lett 2003 Nov 20;554(3):381-8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:28827538	PMID:31038027

Genomics

Comparative Map Data

Gpr135
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	96,363,466 - 96,366,594 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	96,362,867 - 96,382,988 (-)	Ensembl				GRCr8
mRatBN7.2	6	90,627,533 - 90,630,661 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	90,629,178 - 90,630,551 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	90,999,916 - 91,001,289 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	91,299,380 - 91,300,753 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	90,738,936 - 90,740,309 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	94,816,976 - 94,818,349 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	94,816,976 - 94,818,349 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	104,261,635 - 104,263,008 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	94,262,988 - 94,264,361 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	89,094,054 - 89,095,427 (-)	NCBI		Celera
RGSC_v3.1	6	94,266,443 - 94,267,817 (-)	NCBI
Cytogenetic Map	6	q24	NCBI

GPR135
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	59,452,783 - 59,465,380 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	59,429,022 - 59,465,380 (-)	Ensembl			hg38	GRCh38
GRCh37	14	59,927,477 - 59,932,098 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	58,999,993 - 59,001,812 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	58,965,492 - 59,001,812	NCBI
Celera	14	39,979,309 - 39,981,128 (-)	NCBI		Celera
Cytogenetic Map	14	q23.1	NCBI
HuRef	14	40,094,106 - 40,095,925 (-)	NCBI		HuRef
CHM1_1	14	59,868,393 - 59,870,212 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	53,659,699 - 53,672,299 (-)	NCBI		T2T-CHM13v2.0

Gpr135
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	72,114,748 - 72,117,875 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	72,114,750 - 72,117,899 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	72,067,974 - 72,071,101 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	72,067,976 - 72,071,125 (-)	Ensembl			mm10	GRCm38
MGSCv37	12	73,170,605 - 73,171,978 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	72,988,202 - 72,989,575 (-)	NCBI		MGSCv36	mm8
Celera	12	73,180,633 - 73,182,006 (-)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	30.2	NCBI

Gpr135
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	13,188,710 - 13,192,314 (-)	Ensembl
ChiLan1.0	NW_004955466	13,188,710 - 13,194,054 (-)	NCBI	ChiLan1.0	ChiLan1.0

GPR135
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	60,594,838 - 60,603,442 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	59,811,352 - 59,819,941 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	40,064,817 - 40,071,833 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	58,329,664 - 58,332,815 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	58,331,046 - 58,332,449 (-)	Ensembl			panPan2	panpan1.1

GPR135
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	34,683,841 - 34,685,688 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	34,444,248 - 34,446,877 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	34,919,401 - 34,922,039 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	34,919,001 - 34,922,139 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	34,536,642 - 34,539,272 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	34,605,685 - 34,608,329 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	34,972,929 - 34,975,567 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gpr135
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	70,377,446 - 70,378,904 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	3,813,078 - 3,814,256 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	3,812,825 - 3,814,252 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR135
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	188,580,947 - 188,582,434 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	188,580,016 - 188,582,526 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GPR135
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	36,693,214 - 36,695,656 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	36,694,048 - 36,695,547 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	24,947,818 - 24,950,265 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpr135
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624734	41,641,813 - 41,643,929 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gpr135
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	85,738,670 - 85,741,024 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gpr135
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	106
Count of miRNA genes:	88
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000005933
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	64367996	109367996	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
4889933	Bss88	Bone structure and strength QTL 88	3.8		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	6	53684921	98684921	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
5684963	Bss99	Bone structure and strength QTL 99	3.1		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	6	53684921	98684921	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
5684992	Bmd83	Bone mineral density QTL 82	4.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	6	53684921	98684921	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	10	65	152	74	73	48	17	48	6	254	110	9	133	79	92	25	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_181771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY288430	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005933 ⟹ ENSRNOP00000005933

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	96,363,405 - 96,368,309 (-)	Ensembl
mRatBN7.2 Ensembl	6	90,629,178 - 90,630,551 (-)	Ensembl
Rnor_6.0 Ensembl	6	94,816,976 - 94,818,349 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131704 ⟹ ENSRNOP00000100567

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	96,362,867 - 96,382,988 (-)	Ensembl

RefSeq Acc Id:

NM_181771 ⟹ NP_861436

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	96,363,466 - 96,366,594 (-)	NCBI
mRatBN7.2	6	90,627,533 - 90,630,661 (-)	NCBI
Rnor_6.0	6	94,816,976 - 94,818,349 (-)	NCBI
Rnor_5.0	6	104,261,635 - 104,263,008 (-)	NCBI
RGSC_v3.4	6	94,262,988 - 94,264,361 (-)	RGD
Celera	6	89,094,054 - 89,095,427 (-)	RGD

Sequence:

show sequence

ATGGAGGAGCAGGCGCGGCCGCCGAGCCGCCCGGCTGCGAGTGCAACCTTGCCGGGTAGCGCAC
ATCCCGGAGGGGCGGCTTCCACGGCCACCGCGGCCGCGCTGTCGTTCAGCTCCGTAGCCACCGT
AACGCTGGGAAACCAGAGCGATGCGGGCAGGCCGGAGGCGGCTGGGTCTCGGGGACCGGCACCG
CTGCTTTGGCACGGGGCAGCAGTGGCCGCCCAGGCGCTCGTGCTCCTGCTCATCTTCTTACTGT
CTAGCCTGGGAAACTGCGCGGTGATGGGGGTGATCGTGAAGCACCGGCAGCTGCGCACGGTCAC
CAACGCCTTCATCCTATCGCTGTCCCTGTCGGACCTGCTCACTGCGCTGCTCTGCTTACCCGCC
GCCTTCCTCGACCTGTTTGCGCCGCCGGGAGACTCGGGGCCCTGGCGCAGCTTCTGCGCCGCCA
GCCGCTTCTTCAGTTCGTGTTTCGGCATCGTCTCCACGTTCAGCGTGGCGCTCATCTCGCTGGA
CCGCTACTGCGCCATCGTGCGGCCGCCGCGGGACAAGCTAGGCCGGCGGCGCGCGCTGCAGCTG
CTGGCCGGAGCGTGGCTGGCTGCGCTCGGCTTCTCCCTGCCCTGGGAGCTGCTCCGGGCACCCC
GGGAGCCCCCGACTCCGCAGAGCTTCCACCGCTGCCTTTACAGAACCTCCCCAGACCCTGCGCA
GCTGGGCGCCGCTTACAGCGTGGGGCTGGTGGTGGCTTGCTACCTGCTGCCCTTCCTGCTGATG
TGTTTCTGCCGCTACCACATCTGCAAGACTGTGCGCCTGTCGGACGTGCGTGTGCGGCCGATGA
CCACCTATGCGCGCGTGCTGCGCTTTTTCAGCGAGGTGCGCACGGCCACCACCGTGCTCATCAT
GATTGTCTTTGTCATCTGCTGCTGGGGCCCCTACTGCTTCCTGGTGTTGTTGGCTGCTACCCGG
CAGGGTCAGACCACACAGGCTCCCTCGCTGCTCAATGTGGCAGCTGTTTGGCTGACCTGGGCCA
ATGGAGCTATCAACCCGGTCATATATGCCATCCGCAACCCTAACATTTCTATGTTCCTAGGTCG
CAACCGCGAAGAGGGATATAGGACTAGAAACATGGATGTTTTTTTGCCTAGCCAAGGCCTAGGT
TTTCAGGCCAGAAGTCGCAATCGCCTTCGAAATGGCTGTGCCAACAGGCTTGGGGCTTGCAGCA
GGATGCCTTCTTCCAACCCCGCTAGTGGGTCAGGAGGGGAAGTGGTCATGTGGGCTCGAAAAAA
CCCAGTTGTGCTCTTCTTCCGAGAGGATCCACCAGACCCAGTTATGGCAGTCTACAAACAGCAT
AAATCTGAAACCAGGGACAGTAGCATCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_861436	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP72139	(Get FASTA)	NCBI Sequence Viewer
	EDM03583	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005933
	ENSRNOP00000005933.2
GenBank Protein	Q7TQN7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_861436 ⟸ NM_181771

- UniProtKB:

Q7TQN7 (UniProtKB/Swiss-Prot), A6HC28 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEEQARPPSRPAASATLPGSAHPGGAASTATAAALSFSSVATVTLGNQSDAGRPEAAGSRGPAP
LLWHGAAVAAQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLLTALLCLPA
AFLDLFAPPGDSGPWRSFCAASRFFSSCFGIVSTFSVALISLDRYCAIVRPPRDKLGRRRALQL
LAGAWLAALGFSLPWELLRAPREPPTPQSFHRCLYRTSPDPAQLGAAYSVGLVVACYLLPFLLM
CFCRYHICKTVRLSDVRVRPMTTYARVLRFFSEVRTATTVLIMIVFVICCWGPYCFLVLLAATR
QGQTTQAPSLLNVAAVWLTWANGAINPVIYAIRNPNISMFLGRNREEGYRTRNMDVFLPSQGLG
FQARSRNRLRNGCANRLGACSRMPSSNPASGSGGEVVMWARKNPVVLFFREDPPDPVMAVYKQH
KSETRDSSI

hide sequence

Ensembl Acc Id:

ENSRNOP00000005933 ⟸ ENSRNOT00000005933

Ensembl Acc Id:

ENSRNOP00000100567 ⟸ ENSRNOT00000131704

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TQN7-F1-model_v2	AlphaFold	Q7TQN7	1-457	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727844	AgrOrtholog
BioCyc Gene	G2FUF-37157	BioCyc
Ensembl Genes	ENSRNOG00000004499	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005933	ENTREZGENE
	ENSRNOT00000005933.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:314213	UniProtKB/Swiss-Prot
NCBI Gene	314213	ENTREZGENE
PANTHER	G PROTEIN-COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	G-PROTEIN COUPLED RECEPTOR 135	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Gpr135	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004499	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6HC28	ENTREZGENE, UniProtKB/TrEMBL
	GP135_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Gpr135	G protein-coupled receptor 135			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD