Advanced Search (OLGA)

Gene: Spp2 (secreted phosphoprotein 2) Rattus norvegicus

Analyze

Symbol:

Spp2

Name:

secreted phosphoprotein 2

RGD ID:

708488

Description:

Involved in protein-containing complex assembly. Part of protein-containing complex. Orthologous to human SPP2 (secreted phosphoprotein 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC94168; MGC108864; secreted phosphoprotein 2, 24kDa; secreted phosphoprotein 24; spp-24; spp-24 precursor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPP2 (secreted phosphoprotein 2)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Spp2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spp2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPP2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPP2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Spp2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPP2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPP2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Spp2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Spp2 (secreted phosphoprotein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SPP2 (secreted phosphoprotein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spp2 (secreted phosphoprotein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	spp2 (secreted phosphoprotein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	spp2 (secreted phosphoprotein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Bp394 Bmd92

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	96,454,636 - 96,474,453 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	96,454,957 - 96,474,452 (+)	Ensembl				GRCr8
mRatBN7.2	9	89,006,858 - 89,026,676 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	89,007,175 - 89,026,688 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	97,431,671 - 97,451,161 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,567,750 - 102,587,244 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,935,348 - 100,954,840 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	95,501,512 - 95,509,646 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	95,501,778 - 95,506,365 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	95,188,006 - 95,207,531 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	87,297,052 - 87,316,546 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	86,568,178 - 86,587,265 (+)	NCBI		Celera
RGSC_v3.1	9	87,485,301 - 87,520,857 (+)	NCBI
Cytogenetic Map	9	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

fundus dystrophy (ISO)

retinitis pigmentosa 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

calcium atom (EXP)

calcium(0) (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

cobalt dichloride (EXP)

cyclosporin A (ISO)

deoxycholic acid (ISO)

diisononyl phthalate (ISO)

disodium selenite (ISO)

flutamide (EXP)

furan (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

GW 4064 (ISO)

lead nitrate (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methapyrilene (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (EXP,ISO)

propanal (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

triclosan (ISO)

troglitazone (ISO)

uranium atom (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bone remodeling (IEA)

protein-containing complex assembly (IPI)

Cellular Component

extracellular region (IEA)

protein-containing complex (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization of the human secreted phosphoprotein 24 gene (SPP2) and comparison of the protein sequence in nine species.	Bennett CS, etal., Matrix Biol 2004 Feb;22(8):641-51.
2.	Isolation and molecular cloning of a novel bone phosphoprotein related in sequence to the cystatin family of thiol protease inhibitors.	Hu B, etal., J Biol Chem 1995 Jan 6;270(1):431-6.
3.	A new inositol 1,4,5-trisphosphate binding protein similar to phospholipase C-delta 1.	Kanematsu T, etal., Biochem J 1996 Jan 1;313 ( Pt 1):319-25.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Biochemical characterization of the serum fetuin-mineral complex.	Price PA, etal., J Biol Chem. 2003 Jun 13;278(24):22153-60. Epub 2003 Apr 3.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:23376485	PMID:27559042

Genomics

Comparative Map Data

Spp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	96,454,636 - 96,474,453 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	96,454,957 - 96,474,452 (+)	Ensembl				GRCr8
mRatBN7.2	9	89,006,858 - 89,026,676 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	89,007,175 - 89,026,688 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	97,431,671 - 97,451,161 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,567,750 - 102,587,244 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,935,348 - 100,954,840 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	95,501,512 - 95,509,646 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	95,501,778 - 95,506,365 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	95,188,006 - 95,207,531 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	87,297,052 - 87,316,546 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	86,568,178 - 86,587,265 (+)	NCBI		Celera
RGSC_v3.1	9	87,485,301 - 87,520,857 (+)	NCBI
Cytogenetic Map	9	q35	NCBI

SPP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	234,050,702 - 234,077,134 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	234,050,617 - 234,079,344 (+)	Ensembl			hg38	GRCh38
GRCh37	2	234,959,346 - 234,985,778 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	234,624,085 - 234,650,515 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	234,741,345 - 234,767,776	NCBI
Celera	2	228,679,717 - 228,706,136 (+)	NCBI		Celera
Cytogenetic Map	2	q37.1	NCBI
HuRef	2	226,759,047 - 226,785,468 (+)	NCBI		HuRef
CHM1_1	2	234,965,157 - 234,991,581 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	234,539,661 - 234,566,083 (+)	NCBI		T2T-CHM13v2.0

Spp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	88,334,688 - 88,356,022 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	88,334,683 - 88,354,160 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	88,406,966 - 88,428,300 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	88,406,961 - 88,426,438 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	90,303,594 - 90,323,013 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	90,238,190 - 90,257,609 (+)	NCBI		MGSCv36	mm8
Celera	1	91,364,510 - 91,384,363 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	44.63	NCBI

Spp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	2,129,725 - 2,158,715 (-)	Ensembl
ChiLan1.0	NW_004955453	2,130,606 - 2,158,603 (-)	NCBI	ChiLan1.0	ChiLan1.0

SPP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	136,691,588 - 136,717,987 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	136,706,553 - 136,732,952 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	121,294,427 - 121,320,831 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	240,165,495 - 240,191,869 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	240,165,495 - 240,191,869 (+)	Ensembl			panPan2	panpan1.1

SPP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	45,372,221 - 45,395,117 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	45,372,254 - 45,395,082 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	45,870,113 - 45,893,007 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	45,720,067 - 45,742,974 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	45,720,099 - 45,742,938 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	45,612,664 - 45,635,525 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	45,421,183 - 45,444,083 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	45,649,755 - 45,672,647 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Spp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	187,555,734 - 187,578,743 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936525	3,360,990 - 3,383,934 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936525	3,360,978 - 3,384,035 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	134,282,842 - 134,306,862 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	134,282,786 - 134,309,610 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	148,717,389 - 148,717,819 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	120,072,474 - 120,100,269 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	120,073,568 - 120,098,094 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	79,390,547 - 79,433,080 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624847	345,034 - 374,249 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624847	345,296 - 372,206 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Spp2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	160,452,704 - 160,472,785 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Spp2
176 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	17
Count of miRNA genes:	17
Interacting mature miRNAs:	17
Transcripts:	ENSRNOT00000026108
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56047863	101047863	Rat
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	63376862	108376862	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	65657365	108376720	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	86720043	110356905	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	44458256	99506504	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	86720043	121768150	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	64220169	109220169	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	64220169	109220169	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	44458256	121768150	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	64220169	109220169	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	68875497	121768150	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	83161999	118999486	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	85262459	109044727	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	85262459	118999486	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	48718864	108376862	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	64220169	109220169	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	54506504	99506504	Rat

Markers in Region

D9Rat68

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	89,075,358 - 89,075,565 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	95,558,328 - 95,558,534	NCBI	Rnor6.0
Rnor_5.0	9	95,256,210 - 95,256,416	UniSTS	Rnor5.0
RGSC_v3.4	9	87,365,226 - 87,365,433	RGD	RGSC3.4
RGSC_v3.4	9	87,365,227 - 87,365,433	UniSTS	RGSC3.4
Celera	9	86,635,842 - 86,636,048	UniSTS
RGSC_v3.1	9	87,569,995 - 87,570,202	RGD
SHRSP x BN Map	9	56.8299	UniSTS
SHRSP x BN Map	9	56.8299	RGD
FHH x ACI Map	9	59.98	RGD
Cytogenetic Map	9	q35	UniSTS

BI286046

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	96,750,099 - 96,750,248 (+)	Marker Load Pipeline
mRatBN7.2	9	89,302,359 - 89,302,508 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	95,785,676 - 95,785,824	NCBI	Rnor6.0
Rnor_5.0	9	95,491,655 - 95,491,803	UniSTS	Rnor5.0
RGSC_v3.4	9	87,617,618 - 87,617,766	UniSTS	RGSC3.4
Celera	9	86,860,870 - 86,861,018	UniSTS
RH 3.4 Map	9	785.0	UniSTS
Cytogenetic Map	9	q35	UniSTS

D9Mco124

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	91,113,977 - 91,114,199 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	97,679,633 - 97,679,852	RGD	Rnor6.0
Rnor_5.0	9	97,361,349 - 97,361,568	RGD	Rnor5.0
RGSC_v3.4	9	89,708,990 - 89,709,209	RGD	RGSC3.4

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	9	17	71	88	84	59	16	59	5	211	56	6	48	79	57	25	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039084306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC095915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U19485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086805 ⟹ ENSRNOP00000075164

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	96,454,957 - 96,474,452 (+)	Ensembl
mRatBN7.2 Ensembl	9	89,007,175 - 89,026,688 (+)	Ensembl
Rnor_6.0 Ensembl	9	95,501,778 - 95,506,365 (+)	Ensembl

RefSeq Acc Id:

NM_053577 ⟹ NP_446029

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	96,454,957 - 96,474,453 (+)	NCBI
mRatBN7.2	9	89,007,175 - 89,026,676 (+)	NCBI
Rnor_6.0	9	95,501,512 - 95,509,646 (+)	NCBI
Rnor_5.0	9	95,188,006 - 95,207,531 (+)	NCBI
RGSC_v3.4	9	87,297,052 - 87,316,546 (+)	RGD
Celera	9	86,568,178 - 86,587,265 (+)	RGD

Sequence:

show sequence

ATTGACACGGGAATCAATCATCTCTACTGAGGTTCCAGACTGCTTCAGCCAGCCAGGGCAGCTA
GGTCGCAGGTGACAAGGATAAGACAGTCACCCTCGGAAAGAGCTGTAGAGAGGCCATCTCCTTG
GCTCTGGGTCGCCGTCCTCGGGATGGAGCTGGCAACGATGAAGACGCTGGTTATGTTGGTGCTG
GGAATGCACTACTGGTGTGCCTCAGGTTTCCCGGTGTACGACTACGACCCTTCCTCTCTGCAAG
AAGCTCTCAGTGCCTCAGTGGCTAAGGTGAACTCGCAATCCCTGAGTCCTTACCTGTTTCGGGC
GACGCGGAGCTCCCTGAAGAGAGTTAATGTCCTGGATGAAGACACACTGGTCATGAACTTAGAG
TTCACCGTTCAGGAAACTACATGCCTAAGAGAGTCTGGTGATCCCTCCACCTGCGCCTTCCAAA
GGGGCTACTCTGTGCCAACAGCTGCTTGCAGGAGCACAGTGCAGATGTCCAAGGGACAGGTGAA
GGATGTGTGGGCTCACTGCCGCTGGGCGTCCACATCCGAGTCCAACAGCAGTGAGGAGATGATT
TTTGGGGACATGGCAAGATCCCACCGACGAAGAAATGATTATCTACTTGGCTTTCTTTATGATG
AACCCAAAGGTGAGCAGTTCTATGACCGGTCGATTGAGATCACGAGGAGGGGACATCCTCCTGC
CCATAGAAGGTTCCTGAACCTCCAACGCAGAGCAAGAGTCAATTCTGGCTTTGAGTGACATCCT
GGAGATTCCATGAAAGAAAGAGAAGCAGAAGCTGAAATGAAGGACATGGAGAATTGTGTCTTTT
TCCTTTGATAAGCTCCACTTTGCAATAAAGATCTTCCCCTTCCTGTAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039084306 ⟹ XP_038940234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	96,454,636 - 96,474,453 (+)	NCBI
mRatBN7.2	9	89,006,858 - 89,026,676 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446029	(Get FASTA)	NCBI Sequence Viewer
	XP_038940234	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA87903	(Get FASTA)	NCBI Sequence Viewer
	AAH88193	(Get FASTA)	NCBI Sequence Viewer
	EDL92091	(Get FASTA)	NCBI Sequence Viewer
	EDL92092	(Get FASTA)	NCBI Sequence Viewer
	EDL92093	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000075164
GenBank Protein	Q62740	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446029 ⟸ NM_053577
- Peptide Label:	precursor
- UniProtKB:	Q5M874 (UniProtKB/Swiss-Prot), Q62740 (UniProtKB/Swiss-Prot), A6JQJ4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MELATMKTLVMLVLGMHYWCASGFPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKR VNVLDEDTLVMNLEFTVQETTCLRESGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCR WASTSESNSSEEMIFGDMARSHRRRNDYLLGFLYDEPKGEQFYDRSIEITRRGHPPAHRRFLNL QRRARVNSGFE hide sequence

Ensembl Acc Id:

ENSRNOP00000075164 ⟸ ENSRNOT00000086805

RefSeq Acc Id:	XP_038940234 ⟸ XM_039084306
- Peptide Label:	isoform X1
- UniProtKB:	A6JQJ4 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62740-F1-model_v2	AlphaFold	Q62740	1-203	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708488	AgrOrtholog
BioCyc Gene	G2FUF-26797	BioCyc
Ensembl Genes	ENSRNOG00000053244	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000086805	ENTREZGENE
Gene3D-CATH	3.10.450.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7372900	IMAGE-MGC_LOAD
InterPro	Cystatin_sf	UniProtKB/Swiss-Prot
	Spp-24	UniProtKB/Swiss-Prot
KEGG Report	rno:94168	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108864	IMAGE-MGC_LOAD
NCBI Gene	94168	ENTREZGENE
PANTHER	PTHR15444	UniProtKB/Swiss-Prot
	SECRETED PHOSPHOPROTEIN 24	UniProtKB/Swiss-Prot
Pfam	Spp-24	UniProtKB/Swiss-Prot
PhenoGen	Spp2	PhenoGen
RatGTEx	ENSRNOG00000053244	RatGTEx
Superfamily-SCOP	SSF54403	UniProtKB/Swiss-Prot
UniProt	A0A0G2K9X1_RAT	UniProtKB/TrEMBL
	A6JQJ4	ENTREZGENE, UniProtKB/TrEMBL
	A6JQJ5_RAT	UniProtKB/TrEMBL
	A6JQJ6_RAT	UniProtKB/TrEMBL
	Q5M874	ENTREZGENE
	Q62740	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q5M874	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-02-21	Spp2	secreted phosphoprotein 2	SPP2	secreted phosphoprotein 2, 24kDa	Symbol and Name updated	1299863	APPROVED
2004-09-10	SPP2	secreted phosphoprotein 2, 24kDa	LOC94168	spp-24 precursor	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD