Advanced Search (OLGA)

Gene: Ca6 (carbonic anhydrase 6) Rattus norvegicus

Analyze

Symbol:

Ca6 (Ensembl: Car6)

Name:

carbonic anhydrase 6

RGD ID:

70516

Description:

Predicted to enable carbonate dehydratase activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of bitter taste. Predicted to be located in cytosol. Predicted to be active in extracellular space. Orthologous to human CA6 (carbonic anhydrase 6); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Car6; carbonic anhydrase VI; gustin; LOC298657

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CA6 (carbonic anhydrase 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Car6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ca6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CA6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CA6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ca6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CA6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CA6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ca6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ca6 (carbonic anhydrase 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CA6 (carbonic anhydrase 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Car6 (carbonic anhydrase 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ca6 (carbonic anhydrase VI)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18672	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3669	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3669	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5379	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5379	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|SonicParanoid)
Drosophila melanogaster (fruit fly):	caix	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|SonicParanoid)
Drosophila melanogaster (fruit fly):	caix	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3940	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	cah-5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ca6	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Xenopus tropicalis (tropical clawed frog):	ca6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	165,941,028 - 165,959,566 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	165,941,029 - 165,959,566 (-)	Ensembl				GRCr8
mRatBN7.2	5	160,658,104 - 160,676,644 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	160,658,105 - 160,676,644 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	163,374,562 - 163,393,131 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	165,196,252 - 165,214,842 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	165,153,125 - 165,171,662 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	167,226,246 - 167,244,786 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	167,226,246 - 167,244,786 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	170,854,181 - 170,872,721 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	167,332,219 - 167,350,880 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	158,915,352 - 158,933,838 (-)	NCBI		Celera
RGSC_v3.1	5	167,342,413 - 167,361,042 (-)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

6-propyl-2-thiouracil (EXP,ISO)

acetazolamide (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antimycin A (ISO)

arsane (ISO)

arsenic atom (ISO)

Benzo[ghi]perylene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

carmustine (ISO)

corn oil (ISO)

Cuprizon (EXP)

epoxiconazole (ISO)

famotidine (ISO)

fenvalerate (EXP)

genistein (EXP,ISO)

glycidol (EXP)

indole-3-methanol (EXP)

methoxychlor (EXP)

nickel atom (ISO)

oryzalin (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenytoin (EXP)

potassium bromate (ISO)

rotenone (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium fluoride (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of bitter taste (IEA,ISO)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA,ISO)

Molecular Function

carbonate dehydratase activity (IBA,IEA)

lyase activity (IEA)

metal ion binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The identification of secreted carbonic anhydrase VI as a constitutive glycoprotein of human and rat milk.	Karhumaa P, etal., Proc Natl Acad Sci U S A 2001 Sep 25;98(20):11604-8.
3.	Secretion of carbonic anhydrase isoenzyme VI (CA VI) from human and rat lingual serous von Ebner's glands.	Leinonen J, etal., J Histochem Cytochem 2001 May;49(5):657-62.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9858573	PMID:16502470	PMID:16674676	PMID:16674677	PMID:19199708	PMID:24248522	PMID:24789143

Genomics

Comparative Map Data

Ca6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	165,941,028 - 165,959,566 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	165,941,029 - 165,959,566 (-)	Ensembl				GRCr8
mRatBN7.2	5	160,658,104 - 160,676,644 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	160,658,105 - 160,676,644 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	163,374,562 - 163,393,131 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	165,196,252 - 165,214,842 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	165,153,125 - 165,171,662 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	167,226,246 - 167,244,786 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	167,226,246 - 167,244,786 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	170,854,181 - 170,872,721 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	167,332,219 - 167,350,880 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	158,915,352 - 158,933,838 (-)	NCBI		Celera
RGSC_v3.1	5	167,342,413 - 167,361,042 (-)	NCBI
Cytogenetic Map	5	q36	NCBI

CA6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	8,945,868 - 8,975,092 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	8,945,867 - 8,975,092 (+)	Ensembl			hg38	GRCh38
GRCh37	1	9,005,927 - 9,035,151 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	8,928,509 - 8,957,738 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	8,940,207 - 8,969,412	NCBI
Celera	1	8,114,641 - 8,143,865 (+)	NCBI		Celera
Cytogenetic Map	1	p36.23	NCBI
HuRef	1	8,155,174 - 8,184,890 (+)	NCBI		HuRef
CHM1_1	1	8,995,837 - 9,025,073 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	8,479,556 - 8,508,762 (+)	NCBI		T2T-CHM13v2.0

Car6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	150,271,472 - 150,285,592 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	150,271,472 - 150,285,789 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	150,187,015 - 150,201,135 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	150,187,015 - 150,201,332 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	149,561,124 - 149,575,244 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	149,030,815 - 149,042,270 (-)	NCBI		MGSCv36	mm8
Celera	4	152,461,682 - 152,476,184 (-)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	81.12	NCBI

Ca6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	4,234,235 - 4,247,876 (-)	Ensembl
ChiLan1.0	NW_004955486	4,234,293 - 4,249,026 (-)	NCBI	ChiLan1.0	ChiLan1.0

CA6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	219,257,247 - 219,285,951 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	217,902,001 - 217,930,699 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	7,703,187 - 7,732,409 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	8,938,158 - 8,966,305 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	8,938,164 - 8,966,300 (+)	Ensembl			panPan2	panpan1.1

CA6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	62,358,521 - 62,379,901 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	62,358,403 - 62,379,897 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	62,375,992 - 62,397,372 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	62,580,266 - 62,606,464 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	62,584,896 - 62,606,460 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	62,583,427 - 62,604,811 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	62,447,719 - 62,469,108 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	62,851,948 - 62,873,335 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ca6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	32,675,341 - 32,703,732 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936623	3,169,089 - 3,188,956 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936623	3,169,095 - 3,188,947 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CA6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	69,447,439 - 69,468,821 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	69,447,662 - 69,468,819 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	63,673,124 - 63,695,013 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CA6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	122,777,961 - 122,817,689 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	122,777,895 - 122,810,359 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	26,799,675 - 26,832,454 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ca6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	3,180,356 - 3,192,928 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624818	3,179,847 - 3,193,699 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ca6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	10,554,298 - 10,572,504 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ca6
114 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	189
Count of miRNA genes:	126
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000051309
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	160111176	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	156396728	172190305	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	160071170	172129029	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	156396728	167181764	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	156289283	171137955	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat

Markers in Region

RH137414

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	160,658,270 - 160,658,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	167,226,412 - 167,226,609	NCBI	Rnor6.0
Rnor_5.0	5	170,854,347 - 170,854,544	UniSTS	Rnor5.0
RGSC_v3.4	5	167,332,385 - 167,332,582	UniSTS	RGSC3.4
Celera	5	158,915,518 - 158,915,715	UniSTS
RH 3.4 Map	5	1121.4	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	88	59	6	352	188	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001443918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ198382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ200916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051309 ⟹ ENSRNOP00000050476

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	165,941,029 - 165,959,566 (-)	Ensembl
mRatBN7.2 Ensembl	5	160,658,105 - 160,676,644 (-)	Ensembl
Rnor_6.0 Ensembl	5	167,226,246 - 167,244,786 (-)	Ensembl

RefSeq Acc Id:

NM_001134841 ⟹ NP_001128313

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,941,029 - 165,959,566 (-)	NCBI
mRatBN7.2	5	160,658,105 - 160,676,644 (-)	NCBI
Rnor_6.0	5	167,226,246 - 167,244,786 (-)	NCBI
Rnor_5.0	5	170,854,181 - 170,872,721 (-)	NCBI
RGSC_v3.4	5	167,332,219 - 167,350,880 (-)	RGD
Celera	5	158,915,352 - 158,933,838 (-)	RGD

Sequence:

show sequence

CTGCATTCAGGGCTACAGCATCTGCCATGAGGGTTCTGGTGAGCGTGGTGTCCTTGTTCTTCCT
GGGCATCCAGGCCCTCAGTGAGTGGAGCTACTCAGGGGATGACGGCCTGGAAGAGAGTCGGTGG
CCTGAGAAGTACCCTTCCTGCGGCGGGGAAAGGCAGTCGCCCATCGATGTGAAGAGGAGGGAGG
TGCACTTCAGTAGCTCCTTGTTGCCCCTGCACATGGTCAACTATGAGGAGGAGGGGCTGGAGCT
CTCTATGACTAACAACGGACACACAGTACAGATCACCCTGCCGAACACCATGTCCATGAGAGAC
TCTGACGGCACTGTGTACAGGACAAAGCAGATGCACTTTCACTGGGGCGGTCGGGACTCAGAAA
TCAGTGGCTCTGAGCACACCATCGATGGGATGAGGCACGCCATAGAGATTCACCTTGTTCACTT
CAACGAGAAGTACGAGACCTACGAGAAAGCCGTGGACCAACCAGACGGCTTGGCGGTGATGGCG
GTCTTGGTTAAGGTTGAGGATTACACAGAAAACGATTACTACAGCACCTTCATTTCTGAGCTGG
AAAACGTCAAGTATACAGGACAAACCACGACACTGAGAAACGTTAACATCCGGAACATGTTGCC
CGGGGACATCAGACACTACTACACCTACCAAGGCTCGCTCACCACTCCCCCCTGCACGGAGAAC
GTCAAGTGGTTTGTGTTTCAGGATTCCGCCACCATCTCCAAGGCCCAGGCTGAGAGAATAGAGA
ATGCGGTAATGGATCACCACAACCAGACCATTCGAAATGGTTACCGCAGGACGCAGCCCCTCCA
CAACAGGGTGGTGGAAGCCAATTTCCCATACTCCCCGGATGAAGTCTCTAAGAACCACTTTTAC
ATGCACGAGAAGATTTCACACGGTTTGAAACTAAAGAAAATTAAGAAGAAGAGAAACCACAGCC
ATTGAACCGGAAATGAGACACAGACACCAAGGGCTCACCCTGCCCCTTTGCTAAGGAATCCTGG
AATGTGGGTCTCCTTGCAACCTGCAGCAAGGAGATCTCTGACTAACCCAGAGGGAGTTCTCATC
CCTGAGAGGAAGTGGAGCTGCGTCAGCCAGAAGAGAAGGGATGTGGGTGAGACCGAATGGACTT
GGATGGATGTACAAGGAATCAGACCTTCCATAATCCCCTGTCAATCATCCACCTAAATTTGGGG
TCTGCGGATGCAGCTCATGGTAGAGACCTTGTCATGACATTGAGTTTGATCCCCGGCACCAGAA
AAAAAAGAAAATCTTTCACTTTGATCTACGTTATAAATCACCCCGAACCTCCCTTTTTAATGTA
ATAAAGTGATTTTGGAGATTTTCATTTTTAA

hide sequence

RefSeq Acc Id:

XM_039109708 ⟹ XP_038965636

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,941,028 - 165,956,101 (-)	NCBI
mRatBN7.2	5	160,658,104 - 160,673,657 (-)	NCBI

RefSeq Acc Id:

XM_063287483 ⟹ XP_063143553

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	165,941,028 - 165,957,195 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001128313	(Get FASTA)	NCBI Sequence Viewer
	NP_001430847	(Get FASTA)	NCBI Sequence Viewer
	XP_038965636	(Get FASTA)	NCBI Sequence Viewer
	XP_063143553	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABA43707	(Get FASTA)	NCBI Sequence Viewer
	ABA54406	(Get FASTA)	NCBI Sequence Viewer
	EDL81182	(Get FASTA)	NCBI Sequence Viewer
	EDL81183	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050476
	ENSRNOP00000050476.3

RefSeq Acc Id:	NP_001128313 ⟸ NM_001134841
- Peptide Label:	precursor
- UniProtKB:	A6IUD2 (UniProtKB/TrEMBL), F1LQ08 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRVLVSVVSLFFLGIQALSEWSYSGDDGLEESRWPEKYPSCGGERQSPIDVKRREVHFSSSLLP LHMVNYEEEGLELSMTNNGHTVQITLPNTMSMRDSDGTVYRTKQMHFHWGGRDSEISGSEHTID GMRHAIEIHLVHFNEKYETYEKAVDQPDGLAVMAVLVKVEDYTENDYYSTFISELENVKYTGQT TTLRNVNIRNMLPGDIRHYYTYQGSLTTPPCTENVKWFVFQDSATISKAQAERIENAVMDHHNQ TIRNGYRRTQPLHNRVVEANFPYSPDEVSKNHFYMHEKISHGLKLKKIKKKRNHSH hide sequence

Ensembl Acc Id:

ENSRNOP00000050476 ⟸ ENSRNOT00000051309

RefSeq Acc Id:	XP_038965636 ⟸ XM_039109708
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063143553 ⟸ XM_063287483
- Peptide Label:	isoform X1

Protein Domains

Alpha-carbonic anhydrase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LQ08-F1-model_v2	AlphaFold	F1LQ08	1-312	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70516	AgrOrtholog
BioCyc Gene	G2FUF-39078	BioCyc
Ensembl Genes	ENSRNOG00000021355	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000051309	ENTREZGENE
	ENSRNOT00000051309.5	UniProtKB/TrEMBL
Gene3D-CATH	3.10.200.10	UniProtKB/TrEMBL
InterPro	Carbonic_anhydrase_a-class	UniProtKB/TrEMBL
	Carbonic_anhydrase_a-class_cat	UniProtKB/TrEMBL
	Carbonic_anhydrase_a-class_CS	UniProtKB/TrEMBL
	Carbonic_anhydrase_a_sf	UniProtKB/TrEMBL
KEGG Report	rno:298657	UniProtKB/TrEMBL
NCBI Gene	Car6	ENTREZGENE
PANTHER	Euk_COanhd	UniProtKB/TrEMBL
	PTHR18952:SF110	UniProtKB/TrEMBL
Pfam	Carb_anhydrase	UniProtKB/TrEMBL
PhenoGen	Ca6	PhenoGen
PROSITE	ALPHA_CA_1	UniProtKB/TrEMBL
	ALPHA_CA_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021355	RatGTEx
SMART	Carb_anhydrase	UniProtKB/TrEMBL
Superfamily-SCOP	Euk_COanhd	UniProtKB/TrEMBL
UniProt	A6IUD2	ENTREZGENE, UniProtKB/TrEMBL
	F1LQ08	ENTREZGENE, UniProtKB/TrEMBL
	Q3HRV1_RAT	UniProtKB/TrEMBL
	Q3HS81_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-04-28	Ca6	carbonic anhydrase 6	Car6	carbonic anhydrase 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2022-04-18	Car6	carbonic anhydrase 6	Ca6	carbonic anhydrase 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2019-04-16	Ca6	carbonic anhydrase 6	Car6	carbonic anhydrase 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-06	Car6		Ca6	carbonic anhydrase 6	Symbol and Name updated	1299863	APPROVED
2008-05-06	Ca6	carbonic anhydrase 6	Car6	carbonic anhydrase 6	Data merged from RGD:1311969	737654	APPROVED
2005-12-06	Car6	carbonic anhydrase 6	Car6_predicted	carbonic anhydrase 6 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Car6_predicted	carbonic anhydrase 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-06-10	Ca6	carbonic anhydrase 6			Symbol and Name status set to provisional	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	isolated from saliva	69507
gene_expression	isolated from saliva	69508
gene_function	converts bicarbonate to water and carbon dioxide	69507
gene_function	converts bicarbonate to water and carbon dioxide	69508
gene_process	involved in ion, fluid, and acid base balance	69507
gene_process	involved in ion, fluid, and acid base balance	69508
gene_process	participates in taste function by protecting taste receptor cells (TRCs) from apoptosis	69507
gene_process	participates in taste function by protecting taste receptor cells (TRCs) from apoptosis	69508
gene_process	may play a role in normal growth and development of the infant alimentary tract	69507
gene_process	may play a role in normal growth and development of the infant alimentary tract	69508
gene_protein	zinc-binding protein	69507
gene_protein	zinc-binding protein	69508
gene_protein	two major polypeptides of 41 and 37 kDa, plus a minor 56-kDa polypeptide found in saliva	69508

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar