Advanced Search (OLGA)

Gene: A1bg (alpha-1-B glycoprotein) Rattus norvegicus

Analyze

Symbol:

A1bg

Name:

alpha-1-B glycoprotein

RGD ID:

69417

Description:

Predicted to be involved in immune response-regulating signaling pathway. Predicted to act upstream of or within growth hormone receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in plasma membrane. Orthologous to human A1BG (alpha-1-B glycoprotein); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-1B-glycoprotein; C44; liver regeneration-related protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	A1BG (alpha-1-B glycoprotein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	A1BG (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	A1bg (alpha-1-B glycoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	A1BG (alpha-1-B glycoprotein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	A1BG (alpha-1-B glycoprotein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	A1bg (alpha-1-B glycoprotein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	94,383,333 - 94,387,922 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	94,383,333 - 94,387,496 (-)	Ensembl				GRCr8
mRatBN7.2	7	92,493,934 - 92,498,460 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	92,494,372 - 92,498,097 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	94,334,395 - 94,338,558 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	96,535,568 - 96,539,731 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	96,423,846 - 96,428,009 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	102,294,805 - 102,298,522 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	102,294,797 - 102,298,522 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	102,865,631 - 102,869,723 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	97,799,125 - 97,802,842 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	89,209,243 - 89,212,960 (-)	NCBI		Celera
RGSC_v3.1	7	97,833,354 - 97,837,072 (-)	NCBI
Cytogenetic Map	7	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hepatomegaly (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(2E,4E)-hexa-2,4-dienoic acid (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

beta-naphthoflavone (EXP)

bexarotene (EXP)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

clofibrate (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

drometrizole (ISO)

entinostat (ISO)

fenofibrate (EXP)

fructose (EXP,ISO)

indole-3-methanol (EXP)

inulin (ISO)

mercury atom (ISO)

mercury dibromide (ISO)

mercury dichloride (ISO)

mercury(0) (ISO)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

niclosamide (ISO)

okadaic acid (ISO)

olanzapine (ISO)

ozone (EXP)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propanal (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (EXP,ISO)

tetrachloromethane (EXP)

tributylstannane (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

growth hormone receptor signaling pathway (IBA,ISO)

Cellular Component

extracellular region (IEA,ISO,ISS)

plasma membrane (IBA)

Molecular Function

transmembrane signaling receptor activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning of a novel growth hormone-regulated rat complementary deoxyribonucleic acid with homology to the human alpha1B-glycoprotein, characterizing a new protein family.	Gardmo C, etal., Endocrinology 2001 Jun;142(6):2695-701.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
7.	Identification and characterization of differentially expressed genes in the early response phase during liver regeneration.	Xu W, etal., Biochem Biophys Res Commun 2000 Nov 19;278(2):318-25.

Additional References at PubMed

PMID:3458201	PMID:12477932	PMID:15489334	PMID:16502470	PMID:19056867	PMID:22516433	PMID:23376485	PMID:23533145	PMID:27068509	PMID:27559042

Genomics

Comparative Map Data

A1bg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	94,383,333 - 94,387,922 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	94,383,333 - 94,387,496 (-)	Ensembl				GRCr8
mRatBN7.2	7	92,493,934 - 92,498,460 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	92,494,372 - 92,498,097 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	94,334,395 - 94,338,558 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	96,535,568 - 96,539,731 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	96,423,846 - 96,428,009 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	102,294,805 - 102,298,522 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	102,294,797 - 102,298,522 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	102,865,631 - 102,869,723 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	97,799,125 - 97,802,842 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	89,209,243 - 89,212,960 (-)	NCBI		Celera
RGSC_v3.1	7	97,833,354 - 97,837,072 (-)	NCBI
Cytogenetic Map	7	q33	NCBI

A1BG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	58,345,183 - 58,353,492 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	58,345,178 - 58,353,492 (-)	Ensembl			hg38	GRCh38
GRCh37	19	58,856,549 - 58,864,858 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	63,548,356 - 63,556,669 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	63,548,355 - 63,556,669	NCBI
Celera	19	55,902,160 - 55,908,858 (-)	NCBI		Celera
Cytogenetic Map	19	q13.43	NCBI
HuRef	19	55,167,316 - 55,174,020 (-)	NCBI		HuRef
CHM1_1	19	58,852,105 - 58,858,795 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	61,441,599 - 61,449,907 (-)	NCBI		T2T-CHM13v2.0

A1bg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	60,789,438 - 60,793,119 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	60,768,708 - 60,794,861 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	60,917,589 - 60,921,270 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	60,896,859 - 60,923,012 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	60,749,144 - 60,752,825 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	60,747,270 - 60,752,700 (-)	NCBI		MGSCv36	mm8
Celera	15	62,426,399 - 62,430,080 (-)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI
cM Map	15	25.7	NCBI

A1bg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955584	1,025,588 - 1,028,459 (-)	NCBI	ChiLan1.0	ChiLan1.0

A1BG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	64,623,778 - 64,632,428 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	66,411,664 - 66,419,689 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	55,356,023 - 55,362,854 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	64,180,817 - 64,187,423 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	64,180,985 - 64,187,324 (-)	Ensembl			panPan2	panpan1.1

A1BG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	99,593,654 - 99,607,125 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	99,590,051 - 99,607,106 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	99,988,667 - 100,002,163 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	100,234,344 - 100,247,840 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	100,230,261 - 100,248,034 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	99,879,817 - 99,893,314 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	99,592,169 - 99,605,662 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	100,347,319 - 100,360,815 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

A1BG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	62,935,419 - 62,939,622 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	57,653,277 - 57,657,392 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

A1BG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	50,621,794 - 50,629,057 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	50,621,508 - 50,628,347 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	3,920,280 - 3,926,560 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

A1bg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	197,728 - 204,180 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	197,537 - 200,537 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

A1bg
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	237,610,238 - 237,613,956 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in A1bg
38 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	119
Count of miRNA genes:	107
Interacting mature miRNAs:	112
Transcripts:	ENSRNOT00000006273
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	82111245	96700643	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	82111245	95485241	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	4	5	60	62	58	43	20	43	4	100	35	49	9	47	15	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF236054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ302031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006273 ⟹ ENSRNOP00000006273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	94,383,333 - 94,387,496 (-)	Ensembl
mRatBN7.2 Ensembl	7	92,494,372 - 92,498,097 (-)	Ensembl
Rnor_6.0 Ensembl	7	102,294,797 - 102,298,522 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092777

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	92,494,781 - 92,498,097 (-)	Ensembl
Rnor_6.0 Ensembl	7	102,295,214 - 102,297,137 (-)	Ensembl

RefSeq Acc Id:

NM_022258 ⟹ NP_071594

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	94,383,333 - 94,387,496 (-)	NCBI
mRatBN7.2	7	92,493,934 - 92,498,097 (-)	NCBI
Rnor_6.0	7	102,294,805 - 102,298,522 (-)	NCBI
Rnor_5.0	7	102,865,631 - 102,869,723 (-)	NCBI
RGSC_v3.4	7	97,799,125 - 97,802,842 (-)	RGD
Celera	7	89,209,243 - 89,212,960 (-)	RGD

Sequence:

show sequence

AGACACTCCTGCTGGACTGAAGACCCACCATGTCTCTGTTGACTACTGTACTACTTCTCTGGGG
TTTCACTCTGGGCCCAGGAAATGCTCTTTGGCTTAATTCTGGCAGTGAACCTGAACTACGGGCA
GAGCCTCAATCCTTGCTGGAACCCTGGGCAAACCTCACACTGGTCTGCGCAGTTGATTTGCCTA
CCAAGGTCTTCGAGCTGATCATGAATGGGTGGTTCCTGAGTCAAGTCCGACTGGAGACACCGGT
GTTGTCATATCGCTTTTCCCTGGGGGCCATTACAAGTAACAACAGTGGCGTCTACCGCTGCCGA
TGTGGCGTGGAACCCCCTGTTGACATTCAACTGCCAGCGCTGAGCAAGTGGACAATGCTAAGCA
ATGCTTTGGAGGTGACAGGGAAAGAGCCCTTGCCTCCACCCTCAGCTCACGCTGATCCAGTCTC
CTGGATCACACCTGGTGGCCTGCCTGTCTACATCATGTGCCGGGTTGCCATGCGAGGTGTAACC
TACCTGCTGAGGAAGGAAGGGGTGGATGGTACCCAGAAACCTGATGTCCAGCACAAGGGAACGG
CTGGCTTTCTAATCTACAAGCCTGGTAACTACAGCTGCAGCTACCTAACCCATGCAGGAGGCGA
ACCCTCTGAGCCCAGTGCTATTGTGACCATCAAGATGTCTGCCACACAGCTTCCACCCAGTCTG
TGTTTAATGGGAAGTTACCTAACGATCTACCCCCAGAAGACACATGAGACGCTTGCTTGCAAAG
CTCCTCGGAATGCAGCCGAATTCCAACTCAGACAAGGAGAGAGGGTGCTGAATATTCAAGGGTT
CAGCCCCACCAGAGATGCTACCATATACTATGTGAACTTGAAGGAACTGGATAACCAAAGTCCT
TTTACCTGCCGCTACCGTATGCACAAATACATGCATGTTTGGTCGGAGGACAGCAAGCCCGTAG
AGCTGATGTGGAGTGACGAGAAACTACCAGCCCCGGTACTCACTGCAGAGCCATCAAGTCACAA
CCTGGAGCCTGGTTCAACAGTGCAGCTTCGATGTACTGCACACAAGGCTGGCCTGCGCTTTGGC
CTGCAACGCCAGGGCAAACCAGATTTAGTTGTGGTGCAGATGCTGAATTCGTCTGGGACCGAAG
CTGTCTTTGAGCTGCACAATATCTCAACAATCGACTCTGGCAACTACAGTTGTATCTACATGGA
ACAAGCACCACCCTTCTCAGGATCTGCTTCCAGTGAGCCCTTAGAGCTGCGGATAAATGGGCCA
GCACCCAAGCCAAGGCTGGAAGCTCTGTGGAAAGGCAAGGTTCCTCTGGGCCATGAAGCCATCT
TTCAATGCCATGGCCATGTGCCCAGGGTCAGCATGGAGCTGGTACGTGAGGGCTTTAAAACACC
CTTCTGGATGGCTTCAACAACAAGCACCTCAGCTTTTCTGAAGCTGTCCTTCGTCGGTCCCCAA
CATACAGGCAACTACAGCTGCCGCTATACTGCCCTGTCACCCTTCACATTTGAATCAGGGATCA
GTGACCCTGTGGAAGTTGTAGTAGAAGGTAGCTAACATCGCTGCAGACACAGGAAAGTGCCCTT
GGAAAGGGTTGGAGACAGACATAATACACATTCTTCGTGTAAGATGACTTCATTTTCTCAGGAC
TTAATAAAGGTCAAGTAAATTGTTGTGTAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078317 ⟹ XP_038934245

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	94,383,333 - 94,387,922 (-)	NCBI
mRatBN7.2	7	92,493,934 - 92,498,460 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_071594	(Get FASTA)	NCBI Sequence Viewer
	XP_038934245	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF68963	(Get FASTA)	NCBI Sequence Viewer
	AAH89771	(Get FASTA)	NCBI Sequence Viewer
	CAC19029	(Get FASTA)	NCBI Sequence Viewer
	EDM16186	(Get FASTA)	NCBI Sequence Viewer
	EDM16187	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006273
	ENSRNOP00000006273.4
GenBank Protein	Q9EPH1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071594 ⟸ NM_022258
- Peptide Label:	precursor
- UniProtKB:	Q9EPH1 (UniProtKB/Swiss-Prot), Q5EBD6 (UniProtKB/Swiss-Prot), Q9JKL2 (UniProtKB/Swiss-Prot), A6HRN5 (UniProtKB/TrEMBL), A0A8I6A5Z6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLLTTVLLLWGFTLGPGNALWLNSGSEPELRAEPQSLLEPWANLTLVCAVDLPTKVFELIMNG WFLSQVRLETPVLSYRFSLGAITSNNSGVYRCRCGVEPPVDIQLPALSKWTMLSNALEVTGKEP LPPPSAHADPVSWITPGGLPVYIMCRVAMRGVTYLLRKEGVDGTQKPDVQHKGTAGFLIYKPGN YSCSYLTHAGGEPSEPSAIVTIKMSATQLPPSLCLMGSYLTIYPQKTHETLACKAPRNAAEFQL RQGERVLNIQGFSPTRDATIYYVNLKELDNQSPFTCRYRMHKYMHVWSEDSKPVELMWSDEKLP APVLTAEPSSHNLEPGSTVQLRCTAHKAGLRFGLQRQGKPDLVVVQMLNSSGTEAVFELHNIST IDSGNYSCIYMEQAPPFSGSASSEPLELRINGPAPKPRLEALWKGKVPLGHEAIFQCHGHVPRV SMELVREGFKTPFWMASTTSTSAFLKLSFVGPQHTGNYSCRYTALSPFTFESGISDPVEVVVEG S hide sequence

Ensembl Acc Id:

ENSRNOP00000006273 ⟸ ENSRNOT00000006273

RefSeq Acc Id:	XP_038934245 ⟸ XM_039078317
- Peptide Label:	isoform X1
- UniProtKB:	A6HRN6 (UniProtKB/TrEMBL)

Protein Domains

Ig-like Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EPH1-F1-model_v2	AlphaFold	Q9EPH1	1-513	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695362

Promoter ID:

EPDNEW_R5886

Type:

initiation region

Name:

A1bg_1

Description:

alpha-1-B glycoprotein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	102,298,522 - 102,298,582	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69417	AgrOrtholog
BioCyc Gene	G2FUF-33244	BioCyc
Ensembl Genes	ENSRNOG00000004692	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006273	ENTREZGENE
	ENSRNOT00000006273.7	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7326280	IMAGE-MGC_LOAD
InterPro	A1B_glyco/leuk_Ig-like_rcpt	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig-like_Receptors_ImmuneReg	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
KEGG Report	rno:140656	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108566	IMAGE-MGC_LOAD
NCBI Gene	140656	ENTREZGENE
PANTHER	ALPHA-1B-GLYCOPROTEIN	UniProtKB/Swiss-Prot
	MHC CLASS I NK CELL RECEPTOR	UniProtKB/Swiss-Prot
Pfam	Ig_2	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
PhenoGen	A1bg	PhenoGen
PIRSF	Alpha_1B_glycoprot_prd	UniProtKB/Swiss-Prot
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004692	RatGTEx
SMART	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
TIGR	TC202782
UniProt	A0A8I6A5Z6	ENTREZGENE
	A1BG_RAT	UniProtKB/Swiss-Prot
	A6HRN5	ENTREZGENE, UniProtKB/TrEMBL
	A6HRN6	ENTREZGENE, UniProtKB/TrEMBL
	Q5EBD6	ENTREZGENE
	Q9EPH1	ENTREZGENE
	Q9JKL2	ENTREZGENE
UniProt Secondary	Q5EBD6	UniProtKB/Swiss-Prot
	Q9JKL2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	A1bg	alpha-1-B glycoprotein			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains concensus carbohydrate attachment sites and five putative immunoglobin-like domians	68729
gene_expression	highy expressed in regenerating liver after 70% hepatectomy	631955
gene_expression	expression specific to female liver and dependent on continuous growth hormone (GH)	68729
gene_expression	highly expressed exclusively in liver after hepatectomy	631979
gene_expression	highly expressed exclusively in liver after hepatectomy	631980
gene_protein	predicted 131 amino acid protein	68729
gene_regulation	regulated by female-specific growth hormone secretion	631979
gene_regulation	regulated by female-specific growth hormone secretion	631980

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD