Advanced Search (OLGA)

Gene: Sds (serine dehydratase) Rattus norvegicus

Analyze

Symbol:

Sds

Name:

serine dehydratase

RGD ID:

67376

Description:

Enables L-serine ammonia-lyase activity and threonine deaminase activity. Involved in protein-containing complex assembly; response to amino acid; and response to cobalamin. Predicted to be located in cytosol and mitochondrion. Orthologous to human SDS (serine dehydratase); PARTICIPATES IN dihydropyrimidine dehydrogenase deficiency pathway; dimethylglycine dehydrogenase deficiency pathway; nonketotic hyperglycinemia pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

L-serine deaminase; L-serine dehydratase/L-threonine deaminase; L-threonine dehydratase; MGC108581; RATSDHE1; Sdh; SDH2; Sdhe1; TDH

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SDS (serine dehydratase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Sds (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SDS (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SDS (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sds (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SDS (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SDS (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sds (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sds (serine dehydratase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SDSL (serine dehydratase like)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	SDS (serine dehydratase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sds (serine dehydratase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sds (serine dehydratase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sdsl (serine dehydratase-like)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CHA1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sds	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sds	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	41,743,796 - 41,751,108 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	41,743,799 - 41,748,773 (-)	Ensembl				GRCr8
mRatBN7.2	12	36,083,226 - 36,090,540 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	36,083,229 - 36,088,203 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	37,262,405 - 37,269,705 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	37,873,624 - 37,880,924 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	36,926,093 - 36,933,393 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	43,022,020 - 43,029,331 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	42,939,154 - 42,946,472 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	41,812,090 - 41,819,401 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	52,263,691 - 52,271,002 (-)	NCBI		F344_StmMcwi
Rnor_6.0	12	41,620,429 - 41,627,741 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	41,620,393 - 41,627,741 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	43,473,323 - 43,480,635 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	37,281,091 - 37,288,403 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	37,743,289 - 37,750,601 (-)	NCBI		Celera
RGSC_v3.1	12	37,144,510 - 37,151,603 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-nitrofluorene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

4,4'-diaminodiphenylmethane (EXP)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP)

bromobenzene (EXP)

buspirone (EXP)

calcitriol (ISO)

copper atom (EXP)

copper(0) (EXP)

corn oil (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diethyl maleate (EXP)

endosulfan (ISO)

ethanol (EXP)

flutamide (EXP)

glafenine (EXP)

melatonin (ISO)

metformin (EXP)

methotrexate (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

okadaic acid (ISO)

Ortho-topolin riboside (ISO)

ozone (EXP)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenethyl caffeate (EXP)

phenformin (EXP)

phenobarbital (EXP)

piperonyl butoxide (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

resveratrol (EXP,ISO)

rotenone (EXP)

streptozocin (EXP)

tetrachloromethane (EXP)

theophylline (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP)

trovafloxacin (EXP)

valdecoxib (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amino acid metabolic process (IEA)

gluconeogenesis (IEA,TAS)

L-serine catabolic process (IBA,IEA,ISO)

L-threonine catabolic process (IBA)

lipid metabolic process (IEA)

protein-containing complex assembly (IDA)

pyruvate biosynthetic process (IEA,ISO)

response to amino acid (IEP)

response to cobalamin (IEP)

response to nutrient levels (IEP)

small molecule biosynthetic process (IEA)

Cellular Component

cytoplasm (IEA)

Molecular Function

L-serine ammonia-lyase activity (IBA,IDA,IEA,ISO,TAS)

lyase activity (IEA)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

pyridoxal phosphate binding (IEA,ISO)

threonine deaminase activity (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cysteine and methionine metabolic pathway (IEA)

dihydropyrimidine dehydrogenase deficiency pathway (ISO)

dimethylglycine dehydrogenase deficiency pathway (ISO)

glycine, serine and threonine metabolic pathway (IEA)

nonketotic hyperglycinemia pathway (ISO)

sarcosinemia pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Correlation between genetic and cytogenetic maps of the rat.	Andoh Y, etal., Mamm Genome 1998 Apr;9(4):287-93.
2.	Vitamin B12 deficiency results in the abnormal regulation of serine dehydratase and tyrosine aminotransferase activities correlated with impairment of the adenylyl cyclase system in rat liver.	Ebara S, etal., Br J Nutr. 2008 Mar;99(3):503-10. Epub 2007 Aug 29.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Some biochemical and histochemical properties of human liver serine dehydratase.	Kashii T, etal., Int J Biochem Cell Biol. 2005 Mar;37(3):574-89. doi: 10.1016/j.biocel.2004.08.004.
6.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Adaptational modification of serine and threonine metabolism in the liver to essential amino acid deficiency in rats.	Nagao K, etal., Amino Acids. 2009 Mar;36(3):555-62. Epub 2008 Jun 27.
9.	Organization and structure of the 5' flanking region of the rat serine dehydratase gene.	Noda C, etal., J Biochem (Tokyo) 1990 Oct;108(4):622-8.
10.	Evidence for a dimeric structure of rat liver serine dehydratase.	Ogawa H, etal., Int J Biochem Cell Biol 2002 May;34(5):533-43.
11.	Rat serine dehydratase gene codes for two species of mRNA of which only one is translated into serine dehydratase.	Ogawa H, etal., J Biol Chem 1990 Aug 25;265(24):14407-13.
12.	Sequence of the rat serine dehydratase gene.	Ogawa H, etal., Nucleic Acids Res 1988 Nov 25;16(22):10921-3.
13.	Isolation and nucleotide sequence of the cDNA for rat liver serine dehydratase mRNA and structures of the 5' and 3' flanking regions of the serine dehydratase gene.	Ogawa H, etal., Proc Natl Acad Sci U S A 1988 Aug;85(16):5809-13.
14.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
17.	The effect of dietary protein on the amino acid supply and threonine metabolism in the pregnant rat.	Rees WD, etal., Reprod Nutr Dev. 2006 May-Jun;46(3):227-39. Epub 2006 May 30.
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Comprehensive gene review and curation	RGD comprehensive gene curation
20.	Effects of 3,4-dichloroaniline on testicle enzymes as biological markers in rats.	Zhang B and Lin S, Biomed Environ Sci. 2009 Feb;22(1):40-3.

Additional References at PubMed

PMID:2228554	PMID:2228555	PMID:2660911	PMID:3391277	PMID:7581747	PMID:8311466	PMID:12477932	PMID:12882394	PMID:14596599	PMID:15689518	PMID:16793941	PMID:17928680
PMID:18342636	PMID:23087176

Genomics

Comparative Map Data

Sds
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	41,743,796 - 41,751,108 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	41,743,799 - 41,748,773 (-)	Ensembl				GRCr8
mRatBN7.2	12	36,083,226 - 36,090,540 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	36,083,229 - 36,088,203 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	37,262,405 - 37,269,705 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	37,873,624 - 37,880,924 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	36,926,093 - 36,933,393 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	43,022,020 - 43,029,331 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	42,939,154 - 42,946,472 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	41,812,090 - 41,819,401 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	52,263,691 - 52,271,002 (-)	NCBI		F344_StmMcwi
Rnor_6.0	12	41,620,429 - 41,627,741 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	41,620,393 - 41,627,741 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	43,473,323 - 43,480,635 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	37,281,091 - 37,288,403 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	37,743,289 - 37,750,601 (-)	NCBI		Celera
RGSC_v3.1	12	37,144,510 - 37,151,603 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

SDS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	113,392,445 - 113,403,887 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	113,392,423 - 113,426,301 (-)	Ensembl			hg38	GRCh38
GRCh37	12	113,830,250 - 113,841,692 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	112,314,633 - 112,326,075 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	112,292,969 - 112,304,412	NCBI
Celera	12	113,457,510 - 113,468,952 (-)	NCBI		Celera
Cytogenetic Map	12	q24.13	NCBI
HuRef	12	110,841,538 - 110,852,991 (-)	NCBI		HuRef
CHM1_1	12	113,798,461 - 113,809,912 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	113,369,072 - 113,380,515 (-)	NCBI		T2T-CHM13v2.0

Sds
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	9,643,919 - 9,653,375 (-)	Ensembl
ChiLan1.0	NW_004955482	9,646,523 - 9,653,471 (-)	NCBI	ChiLan1.0	ChiLan1.0

SDS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	121,476,515 - 121,491,057 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	121,474,976 - 121,487,221 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	110,995,164 - 111,006,668 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	114,377,643 - 114,388,839 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	114,377,650 - 114,388,839 (-)	Ensembl			panPan2	panpan1.1

SDS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	10,725,123 - 10,728,087 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	10,846,991 - 10,854,892 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	10,969,025 - 10,976,922 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	10,969,027 - 10,976,909 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	10,942,958 - 10,950,862 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	11,005,615 - 11,013,518 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	11,054,755 - 11,062,663 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sds
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	148,709,916 - 148,716,729 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936668	3,206,458 - 3,215,617 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936668	3,208,810 - 3,213,465 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SDS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	38,503,933 - 38,513,878 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	38,503,922 - 38,513,908 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	40,856,187 - 40,866,181 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SDS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	108,643,198 - 108,654,927 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	108,642,694 - 108,654,620 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	136,438,092 - 136,449,669 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sds
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	19,123,927 - 19,132,307 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	19,124,706 - 19,131,757 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sds
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	33,349,194 - 33,354,141 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sds
41 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	183
Count of miRNA genes:	109
Interacting mature miRNAs:	113
Transcripts:	ENSRNOT00000001875, ENSRNOT00000001876
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	34243475	43352593	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

D12Wox15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	41,752,100 - 41,752,257 (+)	Marker Load Pipeline
mRatBN7.2	12	36,091,533 - 36,091,690 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	41,628,734 - 41,628,890	NCBI	Rnor6.0
Rnor_5.0	12	43,481,628 - 43,481,784	UniSTS	Rnor5.0
RGSC_v3.4	12	37,289,396 - 37,289,552	UniSTS	RGSC3.4
Celera	12	37,751,594 - 37,751,750	UniSTS
Cytogenetic Map	12	q16	UniSTS

D12Arb7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	36,091,379 - 36,091,727 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	41,628,580 - 41,628,927	NCBI	Rnor6.0
Rnor_5.0	12	43,481,474 - 43,481,821	UniSTS	Rnor5.0
RGSC_v3.4	12	37,289,241 - 37,289,589	RGD	RGSC3.4
RGSC_v3.4	12	37,289,242 - 37,289,589	UniSTS	RGSC3.4
Celera	12	37,751,440 - 37,751,787	UniSTS
RGSC_v3.1	12	37,152,629 - 37,152,977	RGD
SHRSP x BN Map	12	44.3599	RGD
SHRSP x BN Map	12	44.3599	UniSTS
Cytogenetic Map	12	q16	UniSTS

D12Arb16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	36,088,428 - 36,088,826 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	41,625,632 - 41,626,027	NCBI	Rnor6.0
Rnor_5.0	12	43,478,526 - 43,478,921	UniSTS	Rnor5.0
RGSC_v3.4	12	37,286,294 - 37,286,689	UniSTS	RGSC3.4
Celera	12	37,748,492 - 37,748,887	UniSTS
Cytogenetic Map	12	q16	UniSTS

D12Wox17

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	41,752,081 - 41,752,258 (+)	Marker Load Pipeline
mRatBN7.2	12	36,091,514 - 36,091,691 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	41,628,715 - 41,628,891	NCBI	Rnor6.0
Rnor_5.0	12	43,481,609 - 43,481,785	UniSTS	Rnor5.0
RGSC_v3.4	12	37,289,377 - 37,289,553	UniSTS	RGSC3.4
Celera	12	37,751,575 - 37,751,751	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH141130

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	41,743,485 - 41,743,745 (+)	Marker Load Pipeline
mRatBN7.2	12	36,082,915 - 36,083,175 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	41,620,119 - 41,620,378	NCBI	Rnor6.0
Rnor_5.0	12	43,473,013 - 43,473,272	UniSTS	Rnor5.0
RGSC_v3.4	12	37,280,781 - 37,281,040	UniSTS	RGSC3.4
Celera	12	37,742,979 - 37,743,238	UniSTS
RH 3.4 Map	12	647.4	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	25	94	75	74	43	62	43	6	224	111	1	81	47	65	31	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D00746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J03863	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y00752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001875 ⟹ ENSRNOP00000001875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	41,743,799 - 41,748,773 (-)	Ensembl
mRatBN7.2 Ensembl	12	36,083,229 - 36,088,203 (-)	Ensembl
Rnor_6.0 Ensembl	12	41,620,393 - 41,627,741 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000001876 ⟹ ENSRNOP00000001876

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	41,743,799 - 41,748,773 (-)	Ensembl
mRatBN7.2 Ensembl	12	36,083,229 - 36,088,203 (-)	Ensembl
Rnor_6.0 Ensembl	12	41,620,591 - 41,625,403 (-)	Ensembl

RefSeq Acc Id:

NM_053962 ⟹ NP_446414

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	41,743,796 - 41,751,108 (-)	NCBI
mRatBN7.2	12	36,083,226 - 36,090,540 (-)	NCBI
Dahl_SR_JrHsd	12	43,022,020 - 43,029,331 (-)	NCBI
Lyon_Normotensive	12	42,939,154 - 42,946,472 (-)	NCBI
Lyon_Hypertensive	12	41,812,090 - 41,819,401 (-)	NCBI
F344_StmMcwi	12	52,263,691 - 52,271,002 (-)	NCBI
Rnor_6.0	12	41,620,429 - 41,627,741 (-)	NCBI
Rnor_5.0	12	43,473,323 - 43,480,635 (-)	NCBI
RGSC_v3.4	12	37,281,091 - 37,288,403 (-)	RGD
Celera	12	37,743,289 - 37,750,601 (-)	RGD

Sequence:

show sequence

GACACAGACAAAATCTACCCTTCTCGCTCGCTCTGTCCAGCTCCTCCTGTGCCGGGTGCGGCGG
GGCATACCTGTGATCCCAGCAATTGGGAGACTGAGACAGGAGGATCCAACCTTCAAAGCTACAT
GCCATGGCTGCCCAGGAGTCCCTGCACGTGAAGACCCCACTACGTGACAGCATGGCATTGTCCA
AAGTGGCCGGCACTAGTGTGTTCCTTAAGATGGACAGCTCTCAGCCCTCTGGCTCCTTCAAGAT
CCGAGGCATTGGGCATCTCTGCAAGATGAAGGCAAAACAAGGCTGTAAACATTTCGTCTGCTCT
TCAGCGGGCAACGCGGGCATGGCGACTGCCTATGCTGCCAGGAGGCTGGGCCTCCCAGCCACTA
TTGTTGTGCCAAGCACCACACCTGCCCTCACCATTGAGCGGCTGAAGAACGAAGGGGCCACAGT
TGAAGTGGTGGGAGAGATGCTGGATGAGGCCATCCAACTGGCCAAGGCTCTGGAAAAGAACAAC
CCAGGTTGGGTGTACATCTCCCCCTTCGATGACCCTCTCATCTGGGAAGGCCACACTTCCCTTG
TGAAGGAGCTGAAGGAGACACTGAGCGCCAAGCCCGGGGCCATTGTGCTGTCTGTGGGCGGTGG
AGGCCTGCTGTGCGGAGTGGTCCAGGGGCTGCGGGAGGTGGGCTGGGAGGATGTGCCCATCATC
GCCATGGAGACCTTCGGCGCCCACAGCTTCCACGCTGCCGTCAAGGAAGGAAAGCTGGTCACCC
TGCCCAAGATCACCAGTGTTGCCAAGGCCTTGGGTGTGAACACTGTGGGGGCACAGACCCTGAA
GCTGTTTTACGAACACCCCATTTTCTCTGAGGTCATCTCAGACCAGGAGGCTGTGACTGCTATC
GAGAAGTTCGTAGACGATGAGAAGATCCTGGTGGAGCCCGCGTGTGGCGCTGCCCTGGCTGCAG
TGTACAGCGGTGTGGTGTGCAGGCTGCAGGCTGAGGGCCGACTGCAAACCCCACTGGCCTCGCT
GGTTGTCATTGTGTGTGGTGGCAGCAACATCAGCCTGGCACAGCTGCAGGCACTCAAGGCACAG
CTGGGCCTGAATGAGCTACTCAAGTGATATCTGCTGCTGCCCTGGCCACCCTGAGGGGTCACCA
GCACCCCTGAGTAGGCTGGGTGGGCGTCCGCCTGACAGTGGCCCACCCTCCTTTATCCATGTTT
ATAATATGCACTTTTTCATTGTAAATAAAAATTAATATATATATGTTTATAAAGCAAAAAAAAA
AAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271076 ⟹ XP_063127146

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	41,743,796 - 41,748,691 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446414	(Get FASTA)	NCBI Sequence Viewer
	XP_063127146	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42123	(Get FASTA)	NCBI Sequence Viewer
	AAH88110	(Get FASTA)	NCBI Sequence Viewer
	CAA68721	(Get FASTA)	NCBI Sequence Viewer
	EDM13781	(Get FASTA)	NCBI Sequence Viewer
	EDM13782	(Get FASTA)	NCBI Sequence Viewer
	EDM13783	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001875
	ENSRNOP00000001875.3
GenBank Protein	P09367	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446414 ⟸ NM_053962

- UniProtKB:

Q5M8C4 (UniProtKB/Swiss-Prot), P09367 (UniProtKB/Swiss-Prot), A6J1J3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAQESLHVKTPLRDSMALSKVAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCKHFVCSS
AGNAGMATAYAARRLGLPATIVVPSTTPALTIERLKNEGATVEVVGEMLDEAIQLAKALEKNNP
GWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGGGGLLCGVVQGLREVGWEDVPIIA
METFGAHSFHAAVKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQEAVTAIE
KFVDDEKILVEPACGAALAAVYSGVVCRLQAEGRLQTPLASLVVIVCGGSNISLAQLQALKAQL
GLNELLK

hide sequence

Ensembl Acc Id:

ENSRNOP00000001875 ⟸ ENSRNOT00000001875

Ensembl Acc Id:

ENSRNOP00000001876 ⟸ ENSRNOT00000001876

RefSeq Acc Id:	XP_063127146 ⟸ XM_063271076
- Peptide Label:	isoform X1
- UniProtKB:	A6J1J4 (UniProtKB/TrEMBL)

Protein Domains

Tryptophan synthase beta chain-like PALP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P09367-F1-model_v2	AlphaFold	P09367	1-363	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698667

Promoter ID:

EPDNEW_R9192

Type:

single initiation site

Name:

Sds_1

Description:

serine dehydratase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	41,627,751 - 41,627,811	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:67376	AgrOrtholog
BioCyc Gene	G2FUF-19171	BioCyc
BioCyc Pathway	ILEUSYN-PWY [L-isoleucine biosynthesis I (from threonine)]	BioCyc
	PWY-3661 [glycine betaine degradation I]	BioCyc
	PWY66-428 [L-threonine degradation V]	BioCyc
	SERDEG-PWY [L-serine degradation]	BioCyc
BioCyc Pathway Image	ILEUSYN-PWY	BioCyc
	PWY-3661	BioCyc
	PWY66-428	BioCyc
	SERDEG-PWY	BioCyc
Ensembl Genes	ENSRNOG00000001388	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001875	ENTREZGENE
	ENSRNOT00000001875.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1100	UniProtKB/Swiss-Prot
InterPro	PLP-dep	UniProtKB/Swiss-Prot
	Ser/Thr_Dehydratase	UniProtKB/Swiss-Prot
	Ser/Thr_deHydtase_PyrdxlP-BS	UniProtKB/Swiss-Prot
	Trypto_synt_PLP_dependent	UniProtKB/Swiss-Prot
KEGG Report	rno:25044	UniProtKB/Swiss-Prot
NCBI Gene	25044	ENTREZGENE
PANTHER	L-SERINE DEHYDRATASE/L-THREONINE DEAMINASE	UniProtKB/Swiss-Prot
	THREONINE DEHYDRATASE, MITOCHONDRIAL-RELATED	UniProtKB/Swiss-Prot
Pfam	PALP	UniProtKB/Swiss-Prot
PhenoGen	Sds	PhenoGen
PROSITE	DEHYDRATASE_SER_THR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001388	RatGTEx
Superfamily-SCOP	SSF53686	UniProtKB/Swiss-Prot
UniProt	A6J1J3	ENTREZGENE, UniProtKB/TrEMBL
	A6J1J4	ENTREZGENE, UniProtKB/TrEMBL
	F1LMK6_RAT	UniProtKB/TrEMBL
	P09367	ENTREZGENE
	Q5M8C4	ENTREZGENE
	SDHL_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q5M8C4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2003-04-09	Sds	serine dehydratase			Symbol and Name updated	629477	APPROVED
2003-03-06	Sds	serine dehydratase	Sdh	Serine dehydratase	Data merged from RGD:3652	628472	PROVISIONAL
2002-06-10	Sds	serine dehydratase			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Sdh	Serine dehydratase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_product	dimer with a M(r) of 66,800	633956
gene_transcript	consists of two species of mRNA, due to alternative splicing and transcription initiation but only one transcript is translated into the mature enzyme	633958

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways