Advanced Search (OLGA)

Gene: Dnajc21 (DnaJ heat shock protein family (Hsp40) member C21) Rattus norvegicus

Analyze

Symbol:

Dnajc21

Name:

DnaJ heat shock protein family (Hsp40) member C21

RGD ID:

621729

Description:

Predicted to enable nucleic acid binding activity and zinc ion binding activity. Predicted to be located in cytosol and nucleolus. Predicted to be active in cytoplasm. Orthologous to human DNAJC21 (DnaJ heat shock protein family (Hsp40) member C21); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DnaJ (Hsp40) homolog, subfamily C, member 21; dnaJ homolog subfamily C member 21; DnaJ homology subfamily A member 5; Dnaja5; Gs3; putative regulation protein GS3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	61,146,669 - 61,173,908 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	61,145,142 - 61,174,126 (-)	Ensembl				GRCr8
mRatBN7.2	2	59,419,507 - 59,446,746 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	59,419,510 - 59,446,752 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	66,527,232 - 66,554,464 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	64,648,761 - 64,675,993 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	59,650,122 - 59,677,354 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	60,419,446 - 60,446,656 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	60,419,525 - 60,446,510 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	84,232,491 - 84,250,949 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	59,796,394 - 59,814,160 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	59,235,372 - 59,253,383 (+)	NCBI		Celera
RGSC_v3.1	2	59,724,627 - 59,741,440 (-)	NCBI
Cytogenetic Map	2	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bone Marrow Failure Syndrome 3 (ISO)

Congenital Bone Marrow Failure Syndromes (ISO)

Desbuquois dysplasia (ISO)

Funnel Chest (ISO)

genetic disease (ISO)

Shwachman-Diamond syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

clothianidin (ISO)

cyclosporin A (ISO)

deoxycholic acid (ISO)

diclofenac (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

gold atom (ISO)

gold(0) (ISO)

lead diacetate (ISO)

methidathion (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

nefazodone (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

propiconazole (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

succimer (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tungsten (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IBA)

cytosol (IEA,ISO)

nucleolus (IEA,ISO)

nucleus (IEA)

Molecular Function

metal ion binding (IEA)

nucleic acid binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Information Derived from GenBank Report	RGD, Sept. 2003

Additional References at PubMed

PMID:12477932	PMID:22658674

Genomics

Comparative Map Data

Dnajc21
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	61,146,669 - 61,173,908 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	61,145,142 - 61,174,126 (-)	Ensembl				GRCr8
mRatBN7.2	2	59,419,507 - 59,446,746 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	59,419,510 - 59,446,752 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	66,527,232 - 66,554,464 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	64,648,761 - 64,675,993 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	59,650,122 - 59,677,354 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	60,419,446 - 60,446,656 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	60,419,525 - 60,446,510 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	84,232,491 - 84,250,949 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	59,796,394 - 59,814,160 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	59,235,372 - 59,253,383 (+)	NCBI		Celera
RGSC_v3.1	2	59,724,627 - 59,741,440 (-)	NCBI
Cytogenetic Map	2	q16	NCBI

DNAJC21
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	34,929,559 - 34,958,964 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	34,929,548 - 34,958,964 (+)	Ensembl			hg38	GRCh38
GRCh37	5	34,929,664 - 34,959,069 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	34,965,455 - 34,994,826 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	34,972,033 - 34,991,914	NCBI
Celera	5	34,811,930 - 34,841,301 (+)	NCBI		Celera
Cytogenetic Map	5	p13.2	NCBI
HuRef	5	34,878,351 - 34,907,822 (+)	NCBI		HuRef
CHM1_1	5	34,932,060 - 34,961,432 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	35,176,588 - 35,205,995 (+)	NCBI		T2T-CHM13v2.0

Dnajc21
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	10,446,849 - 10,470,685 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	10,446,842 - 10,470,602 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	10,446,763 - 10,470,568 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	10,446,756 - 10,470,516 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	10,376,518 - 10,400,271 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	10,391,489 - 10,415,326 (-)	NCBI		MGSCv36	mm8
Celera	15	10,243,981 - 10,267,730 (-)	NCBI		Celera
Cytogenetic Map	15	A1	NCBI
cM Map	15	5.35	NCBI

Dnajc21
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	20,060,568 - 20,077,305 (+)	Ensembl
ChiLan1.0	NW_004955426	20,060,734 - 20,076,549 (+)	NCBI	ChiLan1.0	ChiLan1.0

DNAJC21
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	75,378,105 - 75,406,820 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	73,531,737 - 73,560,317 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	75,411,784 - 75,440,485 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	80,695,390 - 80,715,945 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	80,695,390 - 80,719,741 (-)	Ensembl			panPan2	panpan1.1

DNAJC21
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	73,343,618 - 73,372,003 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	73,348,638 - 73,372,009 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	72,944,316 - 72,988,410 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	73,833,571 - 73,877,695 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	73,854,315 - 73,877,947 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	73,581,230 - 73,625,321 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	73,704,791 - 73,748,986 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	74,238,074 - 74,282,180 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dnajc21
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	224,763,759 - 224,791,759 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936518	6,582,924 - 6,608,040 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936518	6,582,170 - 6,608,074 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DNAJC21
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	16	20,523,770 - 20,552,048 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	21,425,676 - 21,454,021 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DNAJC21
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	33,822,468 - 33,848,225 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	33,822,736 - 33,851,840 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666071	24,125,093 - 24,150,986 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dnajc21
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624759	19,951,541 - 19,978,939 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dnajc21
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	170,266,092 - 170,287,051 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dnajc21
212 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	179
Count of miRNA genes:	129
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000024218
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6480225	Gdil1	Gastrointestinal dilation QTL 1			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	58388201	77302351	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	36750344	81750344	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	28889991	73889991	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	44904355	85286097	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	83465677	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	36868643	81868643	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	44904355	89904355	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	33269996	78269996	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	73652666	Rat

Markers in Region

D2Rat175

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	61,166,997 - 61,167,223 (+)	Marker Load Pipeline
mRatBN7.2	2	59,439,834 - 59,440,061 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	60,439,774 - 60,440,000	NCBI	Rnor6.0
Rnor_5.0	2	84,233,710 - 84,233,936	UniSTS	Rnor5.0
RGSC_v3.4	2	59,815,479 - 59,815,856	RGD	RGSC3.4
RGSC_v3.4	2	59,815,576 - 59,815,802	UniSTS	RGSC3.4
Celera	2	59,233,730 - 59,233,956	UniSTS
RGSC_v3.1	2	59,743,712 - 59,744,089	RGD
RH 2.0 Map	2	333.3	RGD
SHRSP x BN Map	2	27.5198	RGD
Cytogenetic Map	2	q16	UniSTS

NM_194283

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	59,419,526 - 59,419,619 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	60,419,466 - 60,419,558	NCBI	Rnor6.0
Rnor_5.0	2	84,250,837 - 84,250,929	UniSTS	Rnor5.0
RGSC_v3.4	2	59,796,414 - 59,796,506	UniSTS	RGSC3.4
Celera	2	59,253,271 - 59,253,363	UniSTS
Cytogenetic Map	2	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF492384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024218 ⟹ ENSRNOP00000024218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	61,146,669 - 61,174,126 (-)	Ensembl
mRatBN7.2 Ensembl	2	59,419,510 - 59,446,752 (-)	Ensembl
Rnor_6.0 Ensembl	2	60,419,525 - 60,446,510 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107017 ⟹ ENSRNOP00000085055

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	61,146,669 - 61,173,908 (-)	Ensembl
mRatBN7.2 Ensembl	2	59,419,510 - 59,446,752 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131268 ⟹ ENSRNOP00000100768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	61,146,669 - 61,169,263 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000163537 ⟹ ENSRNOP00000106351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	61,145,142 - 61,173,946 (-)	Ensembl

RefSeq Acc Id:

NM_138856 ⟹ NP_620211

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	61,146,669 - 61,173,908 (-)	NCBI
mRatBN7.2	2	59,419,507 - 59,446,746 (-)	NCBI
Rnor_6.0	2	60,419,446 - 60,438,358 (-)	NCBI
Rnor_5.0	2	84,232,491 - 84,250,949 (+)	NCBI
RGSC_v3.4	2	59,796,394 - 59,814,160 (-)	RGD
Celera	2	59,235,372 - 59,253,383 (+)	RGD

Sequence:

show sequence

GGAGCAGAACGCAGAGAAGGCGAGGAAGGCAGAGGAGATGAGGAGGCAGCAGAAGTTGAAGCAA
GCCAAGCTGGCAGAGCAGTACAGAGAGCAGAGCTGGATGACTATGGCCAATTTGGAGAAGGAGC
TCCGGGAGATGGAAGCGAGGTACGAAAAGGAGTTTGGAGATGGGTCAGATGAAAACGAAGTGGA
GGAGCAGGAGGCCAAAGACGCAGTAGATGGTAAAGACAGTGAGGAGGCTGAGGAGACTGAGCTT
TACGGTGACCTTTACTGCCCAGCTTGTGACAAATCCTTCAAGACGGAAAAGGCCATGAAGAATC
ACGAGAAGTCCAAGAAGCATCGGGAAATGGTTGCCTTGTTGAAACAGCAGTTGGAGGAGGAGGA
AGAACAGTTTTCAGGAGCTCAAATGGATGAAAATTTATTGAATGCTAATTCTGAGGAAGAAACG
GAAGATATACCAAGGCAAAAGCGTTCTAAAAAACAGAAGAAAAGGAAACAGAAGTCAGTGCAGA
ACTTTGATGACAATTTCAATGAAAATGGAACTGAAGAAGGAGGAAAGATTGATCCAAAAGAGAC
TAAGTCAAATGAAGACAATGCCAAAGAATTAGAAAACAGGCCCCAAGAAAATATCTGTATTACA
GAGACCACAGAAGCCTGTGAGGATCCAAAAAGTGAAGCTAAAAGTGTTCCTAAATCCAAAGGAA
AGAAAACCAAAGATGTGAAGAAATCTGTCAAAGTACCTGCTGAGCCACAACCAGTGAGTGATGT
CCTCATCAGCTGTGCAACTTGCCACAGTGAGTTTCCATCCCGGAATAAACTGTTTGATCATCTA
AAGGCTACTGGTCATGCAAGAGCACCTTCAGCAGCAGCATCTTTAGACAGTGTATCTAGTAGTC
GAAACAAGAAAGAGAAGCGTAGAAATAGATAGGAATTCTGTTCATTCTTTTTTTTTTTTTTAAA
CTGTCTCTAGATTCTGGAACCAAAAACTGAACTGAAATAATCTAGAGTTAAAATTTCAGTGATC
TGCAATTCATTGCATTGTGGAAGATTATTTTTATCTTATAAAGACATTTTTCTTTAATATATAT
TTTTAAACATTTCACTAGTGATTGAATTCTACTTTGCCATCTGAATTCACTTGAATGTTTCCTG
ACAGGTAAATATTATAAATGTGTATTGGGATTTCTCATGTGAACAGAAATGTACAGGGAAAATT
AAATTATTTTGACACATAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_620211	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86587	(Get FASTA)	NCBI Sequence Viewer
	AAI58555	(Get FASTA)	NCBI Sequence Viewer
	AAM09567	(Get FASTA)	NCBI Sequence Viewer
	EDL82992	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024218
	ENSRNOP00000024218.7
	ENSRNOP00000085055.1
	ENSRNOP00000100768.1
	ENSRNOP00000106351.1

RefSeq Acc Id:

NP_620211 ⟸ NM_138856

- UniProtKB:

A0A0G2QC19 (UniProtKB/TrEMBL), A0A8I6GBG8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRRQQKLKQAKLAEQYREQSWMTMANLEKELREMEARYEKEFGDGSDENEVEEQEAKDAVDGKD
SEEAEETELYGDLYCPACDKSFKTEKAMKNHEKSKKHREMVALLKQQLEEEEEQFSGAQMDENL
LNANSEEETEDIPRQKRSKKQKKRKQKSVQNFDDNFNENGTEEGGKIDPKETKSNEDNAKELEN
RPQENICITETTEACEDPKSEAKSVPKSKGKKTKDVKKSVKVPAEPQPVSDVLISCATCHSEFP
SRNKLFDHLKATGHARAPSAAASLDSVSSSRNKKEKRRNR

hide sequence

Ensembl Acc Id:

ENSRNOP00000024218 ⟸ ENSRNOT00000024218

Ensembl Acc Id:

ENSRNOP00000085055 ⟸ ENSRNOT00000107017

Ensembl Acc Id:

ENSRNOP00000106351 ⟸ ENSRNOT00000163537

Ensembl Acc Id:

ENSRNOP00000100768 ⟸ ENSRNOT00000131268

Protein Domains

C2H2-type J

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2QC19-F1-model_v2	AlphaFold	A0A0G2QC19	1-533	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621729	AgrOrtholog
BioCyc Gene	G2FUF-54084	BioCyc
Ensembl Genes	ENSRNOG00000017876	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024218	ENTREZGENE
	ENSRNOT00000024218.8	UniProtKB/TrEMBL
	ENSRNOT00000107017.2	UniProtKB/TrEMBL
	ENSRNOT00000131268.1	UniProtKB/TrEMBL
	ENSRNOT00000163537.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.110	UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7380100	IMAGE-MGC_LOAD
InterPro	Chaperone_stress_response	UniProtKB/TrEMBL
	DnaJ_dom_sf	UniProtKB/TrEMBL
	DnaJ_domain	UniProtKB/TrEMBL
	DnaJ_domain_CS	UniProtKB/TrEMBL
	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_jaz	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
	Znf_U1	UniProtKB/TrEMBL
	ZUO1-like_ZHD	UniProtKB/TrEMBL
KEGG Report	rno:192210	UniProtKB/TrEMBL
MGC_CLONE	MGC:187225	IMAGE-MGC_LOAD
NCBI Gene	192210	ENTREZGENE
PANTHER	DNAJ HOMOLOG SUBFAMILY C MEMBER 21	UniProtKB/TrEMBL
	DNAJ HOMOLOG SUBFAMILY C MEMBER 21	UniProtKB/TrEMBL
Pfam	DnaJ	UniProtKB/TrEMBL
	zf-C2H2_jaz	UniProtKB/TrEMBL
	ZUO1-like_ZHD	UniProtKB/TrEMBL
PhenoGen	Dnajc21	PhenoGen
PRINTS	JDOMAIN	UniProtKB/TrEMBL
PROSITE	DNAJ_1	UniProtKB/TrEMBL
	DNAJ_2	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017876	RatGTEx
SMART	DnaJ	UniProtKB/TrEMBL
	ZnF_C2H2	UniProtKB/TrEMBL
	ZnF_U1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46565	UniProtKB/TrEMBL
	SSF57667	UniProtKB/TrEMBL
UniProt	A0A0G2QC19	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GBG8	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LBU2_RAT	UniProtKB/TrEMBL
	A0ABK0LVL8_RAT	UniProtKB/TrEMBL
	Q5RJL8_RAT	UniProtKB/TrEMBL
UniProt Secondary	F1LPX6	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Dnajc21	DnaJ heat shock protein family (Hsp40) member C21	Dnajc21	DnaJ (Hsp40) homolog, subfamily C, member 21	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-19	Dnajc21	DnaJ (Hsp40) homolog, subfamily C, member 21	Dnaja5	DnaJ homology subfamily A member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Dnaja5	DnaJ homology subfamily A member 5	Gs3	putative regulation protein GS3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-08-07	Gs3	putative regulation protein GS3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM