Advanced Search (OLGA)

Gene: Taar1 (trace-amine-associated receptor 1) Rattus norvegicus

Analyze

Symbol:

Taar1

Name:

trace-amine-associated receptor 1

RGD ID:

621621

Description:

Predicted to enable trace-amine receptor activity. Involved in positive regulation of cAMP/PKA signal transduction. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in endomembrane system and plasma membrane. Orthologous to human TAAR1 (trace amine associated receptor 1); INTERACTS WITH (S)-amphetamine; 17beta-estradiol; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

taR-1; Tar1; trace amine associated receptor 1; trace amine receptor 1; trace amine-associated receptor 1; Trar1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,336,978 - 23,337,976 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	23,335,165 - 23,353,981 (-)	Ensembl				GRCr8
mRatBN7.2	1	21,517,742 - 21,518,740 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,517,258 - 21,532,084 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	21,297,006 - 21,298,004 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,297,051 - 27,298,049 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,494,378 - 21,495,376 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,595,477 - 22,596,475 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,595,477 - 22,596,475 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	24,070,405 - 24,071,403 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	22,045,364 - 22,046,362 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	20,260,820 - 20,261,818 (-)	NCBI		Celera
RGSC_v3.1	1	22,048,308 - 22,049,307 (-)	NCBI
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

schizophrenia (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-noradrenaline (ISO)

(R)-octopamine (ISO)

(S)-amphetamine (EXP,ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO)

17beta-estradiol (EXP)

2-palmitoylglycerol (ISO)

2-phenylethylamine (ISO)

3',5'-cyclic AMP (ISO)

3,4-methylenedioxymethamphetamine (EXP,ISO)

3-methoxytyramine (ISO)

4-methoxyphenylethylamine (ISO)

4-methoxytyramine (ISO)

4-phenyl-1,2,3,4-tetrahydroisoquinoline (ISO)

5-methoxytryptamine (ISO)

acrylamide (EXP)

ammonium chloride (EXP)

antazoline (ISO)

bisphenol A (EXP)

citalopram (ISO)

clonidine (ISO)

clonidine (amino form) (ISO)

clonidine (imino form) (ISO)

desipramine (ISO)

dichloroacetic acid (ISO)

dopamine (ISO)

epoxiconazole (ISO)

fenoldopam (ISO)

fenvalerate (EXP)

flavonoids (EXP)

gentamycin (EXP)

Guanabenz (ISO)

harman (ISO)

histamine (ISO)

idazoxan (ISO)

m-tyramine (ISO)

methamphetamine (ISO)

methylphenidate (ISO)

Moxonidine (ISO)

N-methylquipazine (ISO)

octopamine (ISO)

phenobarbital (ISO)

Rilmenidine (ISO)

serotonin (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tranylcypromine (ISO)

tryptamine (ISO)

tryptamines (ISO)

tyramine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

G protein-coupled receptor signaling pathway (IBA,IEA,ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

positive regulation of cAMP/PKA signal transduction (IDA)

signal transduction (IEA)

Cellular Component

endomembrane system (IEA,ISO)

endoplasmic reticulum membrane (IEA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

G protein-coupled amine receptor activity (IEA,ISO)

G protein-coupled receptor activity (IEA,ISO)

trace-amine receptor activity (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Amphetamine, 3,4-methylenedioxymethamphetamine, lysergic acid diethylamide, and metabolites of the catecholamine neurotransmitters are agonists of a rat trace amine receptor.	Bunzow JR, etal., Mol Pharmacol 2001 Dec;60(6):1181-8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Trace amine-associated receptor 1 activation silences GSK3beta signaling of TAAR1 and D2R heteromers.	Harmeier A, etal., Eur Neuropsychopharmacol. 2015 Nov;25(11):2049-61. doi: 10.1016/j.euroneuro.2015.08.011. Epub 2015 Aug 20.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11459929	PMID:15718104	PMID:15955414	PMID:21073468	PMID:22442117	PMID:23072560	PMID:27544651	PMID:28123023	PMID:35346791

Genomics

Comparative Map Data

Taar1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,336,978 - 23,337,976 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	23,335,165 - 23,353,981 (-)	Ensembl				GRCr8
mRatBN7.2	1	21,517,742 - 21,518,740 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,517,258 - 21,532,084 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	21,297,006 - 21,298,004 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,297,051 - 27,298,049 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,494,378 - 21,495,376 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,595,477 - 22,596,475 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,595,477 - 22,596,475 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	24,070,405 - 24,071,403 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	22,045,364 - 22,046,362 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	20,260,820 - 20,261,818 (-)	NCBI		Celera
RGSC_v3.1	1	22,048,308 - 22,049,307 (-)	NCBI
Cytogenetic Map	1	p12	NCBI

TAAR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	132,643,312 - 132,659,182 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	132,643,312 - 132,659,182 (-)	Ensembl			hg38	GRCh38
GRCh37	6	132,964,451 - 132,980,321 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	133,007,816 - 133,008,835 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	133,007,815 - 133,008,835	NCBI
Celera	6	133,712,961 - 133,713,980 (-)	NCBI		Celera
Cytogenetic Map	6	q23.2	NCBI
HuRef	6	130,541,047 - 130,542,066 (-)	NCBI		HuRef
CHM1_1	6	133,229,781 - 133,230,800 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	133,838,279 - 133,854,151 (-)	NCBI		T2T-CHM13v2.0

Taar1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	23,796,304 - 23,797,302 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	23,796,254 - 23,797,367 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	23,920,406 - 23,921,404 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	23,920,356 - 23,921,469 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	23,640,212 - 23,641,210 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	23,609,822 - 23,610,820 (+)	NCBI		MGSCv36	mm8
Celera	10	24,853,896 - 24,854,894 (+)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	11.39	NCBI

Taar1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	13,205,777 - 13,206,793 (-)	Ensembl
ChiLan1.0	NW_004955436	13,204,876 - 13,207,928 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100977974
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	152,626,456 - 152,642,289 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	150,533,544 - 150,549,377 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	130,420,169 - 130,436,032 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	134,529,110 - 134,530,455 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	134,529,418 - 134,530,437 (-)	Ensembl			panPan2	panpan1.1

TAAR4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	1	26,633,763 - 26,634,809 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	25,557,860 - 25,558,906 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	25,557,860 - 25,558,906 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	25,603,937 - 25,604,983 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	25,502,722 - 25,503,768 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	25,765,932 - 25,766,978 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Taar1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	120,896,284 - 120,897,306 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	675,500 - 676,522 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936560	675,500 - 676,522 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAAR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	31,037,826 - 31,050,816 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	34,568,566 - 34,570,037 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAAR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	40,874,400 - 40,891,408 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	40,889,682 - 40,890,698 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	13,078,475 - 13,081,371 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Taar1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	209,982,371 - 209,983,412 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Taar1
15 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	24
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000021510
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	5293229	34184556	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	7746118	52746118	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	7746121	52746121	Rat
70179	Xhs2	X-ray hypersensitivity QTL 2	3.2		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	1	1	43965634	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	26564886	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	10379492	55379492	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	6941022	51941022	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	5293229	34184556	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	6909353	51909353	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	17315378	51816258	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	1	26564886	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	6909353	51909353	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	6909353	51909353	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	12820494	57820494	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	1	34184556	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	20656420	65656420	Rat
1300170	Rf6	Renal function QTL 6	3.14		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	1	1	28483164	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	20508326	65508326	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	11684464	56684464	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	5293229	34184556	Rat

Markers in Region

Taar1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	21,517,808 - 21,518,634 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	22,595,544 - 22,596,369	NCBI	Rnor6.0
Rnor_5.0	1	24,070,472 - 24,071,297	UniSTS	Rnor5.0
RGSC_v3.4	1	22,045,431 - 22,046,256	UniSTS	RGSC3.4
Celera	1	20,260,887 - 20,261,712	UniSTS
Cytogenetic Map	1	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
10	7	6	32	31	29	3	29	56	12	5	5	30	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF380186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF421352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY702315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021510 ⟹ ENSRNOP00000021510

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	23,335,165 - 23,353,981 (-)	Ensembl
mRatBN7.2 Ensembl	1	21,517,258 - 21,520,623 (-)	Ensembl
Rnor_6.0 Ensembl	1	22,595,477 - 22,596,475 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097590 ⟹ ENSRNOP00000076392

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	23,335,861 - 23,352,182 (-)	Ensembl
mRatBN7.2 Ensembl	1	21,517,258 - 21,532,084 (-)	Ensembl

RefSeq Acc Id:

NM_134328 ⟹ NP_599155

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	23,336,978 - 23,337,976 (-)	NCBI
mRatBN7.2	1	21,517,742 - 21,518,740 (-)	NCBI
Rnor_6.0	1	22,595,477 - 22,596,475 (-)	NCBI
Rnor_5.0	1	24,070,405 - 24,071,403 (-)	NCBI
RGSC_v3.4	1	22,045,364 - 22,046,362 (-)	RGD
Celera	1	20,260,820 - 20,261,818 (-)	RGD

Sequence:

show sequence

ATGCATCTTTGCCACAATAGCGCGAATATTTCCCACACGAACAGCAACTGGTCAAGGGATGTCC
GTGCTTCACTGTACAGCTTAATATCACTCATAATTCTAACCACTCTGGTTGGCAACTTAATAGT
AATCATTTCGATATCCCACTTCAAGCAACTTCACACGCCCACAAATTGGCTCCTTCATTCCATG
GCCGTTGTCGACTTTCTGCTGGGCTGTCTGGTCATGCCCTACAGCATGGTGAGAACAGTTGAGC
ACTGCTGGTACTTTGGGGAACTCTTCTGCAAACTTCACACCAGCACTGATATCATGCTGAGCTC
GGCATCCATTCTCCACCTAGCCTTCATTTCCATTGACCGCTACTATGCTGTGTGCGACCCTTTA
AGATACAAAGCCAAGATCAATCTCGCCGCCATTTTTGTGATGATCCTCATTAGCTGGAGCCTTC
CTGCTGTTTTTGCATTTGGGATGATCTTCCTGGAGCTGAACTTAGAAGGAGTTGAGGAGCAGTA
TCACAATCAGGTCTTCTGCCTGCGCGGCTGTTTTCCCTTCTTCAGTAAAGTATCTGGGGTACTG
GCATTCATGACGTCTTTCTATATACCTGGATCTGTTATGTTATTTGTTTACTATAGAATATATT
TCATAGCTAAAGGACAAGCGAGGTCAATTAATCGTGCAAATCTTCAAGTTGGATTGGAAGGGGA
AAGCAGAGCGCCACAAAGCAAGGAAACAAAAGCCGCAAAAACCTTAGGGATCATGGTGGGCGTT
TTCCTCCTGTGCTGGTGCCCGTTCTTTTTCTGCATGGTCCTGGACCCTTTCCTGGGCTATGTTA
TCCCACCCACTCTGAATGACACACTGAATTGGTTCGGGTACCTGAACTCTGCCTTCAACCCGAT
GGTTTATGCCTTTTTCTATCCCTGGTTCAGAAGAGCGTTGAAGATGGTTCTCTTCGGTAAAATT
TTCCAAAAAGATTCATCTAGGTCTAAGTTATTTTTGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599155	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK71237	(Get FASTA)	NCBI Sequence Viewer
	AAL65137	(Get FASTA)	NCBI Sequence Viewer
	AAV70127	(Get FASTA)	NCBI Sequence Viewer
	EDL87747	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021510
GenBank Protein	Q923Y9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599155 ⟸ NM_134328

- UniProtKB:

Q8VHQ5 (UniProtKB/Swiss-Prot), Q5QD26 (UniProtKB/Swiss-Prot), Q923Y9 (UniProtKB/Swiss-Prot), A0A0G2JSP2 (UniProtKB/TrEMBL), A6JUN2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWLLHSM
AVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDRYYAVCDPL
RYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEEQYHNQVFCLRGCFPFFSKVSGVL
AFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQSKETKAAKTLGIMVGV
FLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMVYAFFYPWFRRALKMVLFGKI
FQKDSSRSKLFL

hide sequence

Ensembl Acc Id:

ENSRNOP00000021510 ⟸ ENSRNOT00000021510

Ensembl Acc Id:

ENSRNOP00000076392 ⟸ ENSRNOT00000097590

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q923Y9-F1-model_v2	AlphaFold	Q923Y9	1-332	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621621	AgrOrtholog
BioCyc Gene	G2FUF-62079	BioCyc
Ensembl Genes	ENSRNOG00000016073	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000021510	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	TAAR	UniProtKB/Swiss-Prot
	TAAR1	UniProtKB/Swiss-Prot
	TAAR_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:113914	UniProtKB/Swiss-Prot
NCBI Gene	113914	ENTREZGENE
PANTHER	HISTAMINE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	TRACE AMINE-ASSOCIATED RECEPTOR 1	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Taar1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	TRACEAMINE1R	UniProtKB/Swiss-Prot
	TRACEAMINER	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016073	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A0A0G2JSP2	ENTREZGENE, UniProtKB/TrEMBL
	A6JUN2	ENTREZGENE, UniProtKB/TrEMBL
	Q5QD26	ENTREZGENE
	Q8VHQ5	ENTREZGENE
	Q923Y9	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q5QD26	UniProtKB/Swiss-Prot
	Q8VHQ5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-02-23	Taar1	trace-amine-associated receptor 1	Trar1	trace amine receptor 1	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2004-09-10	Trar1	trace amine receptor 1	Tar1		Symbol updated	1299863	APPROVED
2002-08-07	Tar1				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - MGI