Advanced Search (OLGA)

Gene: Utp11 (UTP11, small subunit processome component) Rattus norvegicus

Analyze

Symbol:

Utp11

Name:

UTP11, small subunit processome component

RGD ID:

621412

Description:

Predicted to be involved in nervous system development; positive regulation of apoptotic process; and ribosomal small subunit biogenesis. Predicted to be located in cytoplasm and extracellular space. Predicted to be part of small-subunit processome. Predicted to be active in nucleolus. Orthologous to human UTP11 (UTP11 small subunit processome component); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Cgi-94; Cgi94; comparative gene identification transcript 94; hypothetical protein LOC313581; LOC313581; probable U3 small nucleolar RNA-associated protein 11; RGD1559610; similar to CGI-94 protein; U3 snoRNA-associated protein 11; UTP11, small subunit processome component homolog; UTP11, small subunit processome component homolog (S. cerevisiae); UTP11-like protein; UTP11-like, U3 small nucleolar ribonucleoprotein; UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast); Utp11l

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UTP11 (UTP11 small subunit processome component)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Utp11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Utp11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UTP11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UTP11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Utp11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UTP11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UTP11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Utp11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Utp11 (UTP11 small subunit processome component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	UTP11 (UTP11 small subunit processome component)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Utp11 (UTP11 small subunit processome component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	utp11 (UTP11 small subunit processome component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1789	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C16C10.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UTP11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	utp11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	utp11	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	142,215,974 - 142,230,859 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	142,215,975 - 142,230,859 (-)	Ensembl				GRCr8
mRatBN7.2	5	136,931,279 - 136,946,164 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	136,931,008 - 136,946,191 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	139,634,525 - 139,649,505 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	141,404,538 - 141,419,516 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	141,411,719 - 141,426,695 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	142,666,288 - 142,681,173 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	142,666,289 - 142,681,173 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	146,437,399 - 146,452,289 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	144,003,627 - 144,018,513 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	135,454,646 - 135,469,575 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

disulfiram (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

FR900359 (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

indometacin (ISO)

kojic acid (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorohexanesulfonic acid (ISO)

piroxicam (ISO)

resveratrol (ISO)

selenium atom (ISO)

senecionine (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

nervous system development (IEA,ISO)

positive regulation of apoptotic process (IEA,ISO)

ribosomal small subunit biogenesis (IEA,ISO,ISS)

rRNA processing (IEA)

Cellular Component

cytoplasm (IEA,ISO)

extracellular space (IEA,ISO)

nucleolus (IBA,IEA,ISO)

small-subunit processome (IBA,IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Characterizing CGI-94 (comparative gene identification-94) which is down-regulated in the hippocampus of early stage Alzheimer's disease brain.	Heese K, etal., Eur J Neurosci 2002 Jan;15(1):79-86.
3.	Comparative gene identification-94--a pivotal regulator of apoptosis.	Heese K, etal., Neuroscience 2003;116(2):321-4.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:22658674	PMID:22681889

Genomics

Comparative Map Data

Utp11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	142,215,974 - 142,230,859 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	142,215,975 - 142,230,859 (-)	Ensembl				GRCr8
mRatBN7.2	5	136,931,279 - 136,946,164 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	136,931,008 - 136,946,191 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	139,634,525 - 139,649,505 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	141,404,538 - 141,419,516 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	141,411,719 - 141,426,695 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	142,666,288 - 142,681,173 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	142,666,289 - 142,681,173 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	146,437,399 - 146,452,289 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	144,003,627 - 144,018,513 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	135,454,646 - 135,469,575 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

UTP11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	38,012,734 - 38,024,820 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	38,009,111 - 38,024,820 (+)	Ensembl			hg38	GRCh38
GRCh37	1	38,478,406 - 38,490,492 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	38,250,971 - 38,263,084 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	36,757,020 - 36,769,134 (+)	NCBI		Celera
Cytogenetic Map	1	p34.3	NCBI
HuRef	1	36,596,946 - 36,609,059 (+)	NCBI		HuRef
CHM1_1	1	38,594,085 - 38,606,194 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	37,879,913 - 37,892,000 (+)	NCBI		T2T-CHM13v2.0

Utp11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	124,571,173 - 124,587,395 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	124,571,953 - 124,587,393 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	124,678,232 - 124,693,610 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	124,678,160 - 124,693,600 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	124,356,008 - 124,370,798 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	124,181,068 - 124,195,858 (-)	NCBI		MGSCv36	mm8
Celera	4	123,004,367 - 123,019,143 (-)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	57.87	NCBI

Utp11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	15,733,018 - 15,743,678 (+)	Ensembl
ChiLan1.0	NW_004955452	15,733,479 - 15,743,545 (+)	NCBI	ChiLan1.0	ChiLan1.0

UTP11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	188,814,187 - 188,826,005 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	187,943,343 - 187,955,164 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	37,286,274 - 37,297,368 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	38,634,008 - 38,645,068 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	38,633,935 - 38,645,068 (+)	Ensembl			panPan2	panpan1.1

UTP11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	4,569,002 - 4,579,065 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	4,568,202 - 4,579,023 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	4,810,822 - 4,821,250 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	4,696,591 - 4,707,069 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	4,696,584 - 4,707,060 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	4,557,164 - 4,567,601 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	4,623,483 - 4,633,891 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	4,639,987 - 4,650,429 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Utp11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	54,307,541 - 54,319,032 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	20,132,253 - 20,143,981 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	20,132,300 - 20,143,814 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UTP11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	93,993,593 - 94,006,898 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	93,993,686 - 94,006,889 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	86,764,391 - 86,777,591 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UTP11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	94,845,537 - 94,858,198 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	94,845,560 - 94,858,192 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	21,967,810 - 21,980,384 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Utp11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	20,656,380 - 20,668,896 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624764	20,656,349 - 20,665,739 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Utp11
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	33,607,740 - 33,623,379 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Utp11
56 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	58
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000009882
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
7411722	Strs6	Sensitivity to stroke QTL 6	3.9		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	5	140258140	143398122	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009882 ⟹ ENSRNOP00000009882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	142,215,975 - 142,230,859 (-)	Ensembl
mRatBN7.2 Ensembl	5	136,931,008 - 136,946,191 (-)	Ensembl
Rnor_6.0 Ensembl	5	142,666,289 - 142,681,173 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101405 ⟹ ENSRNOP00000083956

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	136,931,008 - 136,937,155 (-)	Ensembl

RefSeq Acc Id:

NM_001107978 ⟹ NP_001101448

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	142,215,974 - 142,230,859 (-)	NCBI
mRatBN7.2	5	136,931,279 - 136,946,164 (-)	NCBI
Rnor_6.0	5	142,666,288 - 142,681,173 (-)	NCBI
Rnor_5.0	5	146,437,399 - 146,452,289 (-)	NCBI
RGSC_v3.4	5	144,003,627 - 144,018,513 (-)	ENTREZGENE
Celera	5	135,454,646 - 135,469,575 (-)	RGD

Sequence:

show sequence

CGCGGCTGGTTCTTGTAGTGCGGTCGCCGTGGTGGAGTTTGCCGAGCATTTCTTAGACCTCAGG
AGGCATGTCGGCGGCTTTTCGCAAGGCAGCCAAGACCCGGCAGCGGGAACACCGAGAACGAAGC
CAGCCTGGCTTTCGGAAACGCCTGGGTTTGCTAGAGAAAAAGAAAGATTACAAACTCCGTGCAA
ATGACTATCATAAAAAACAAGATTTCCTCAGAGCTCTCCGGAAGAAGGCTCTTGAAAAAAATCC
AGATGAATTCTACTATAAAATGACTCGGGCCAAGCTCCAGGACGGAGTTCATATTTTCAAAGAC
AACAAGGAAGAAGTGACAGCAGAGCAGCTAAAACTGATGAGAACTCAGGACATCAAGTACATAG
AGATGAAGAGGGTGGCGGAGGCGAAGAAAATTGAAAGACTGAAATCAGAGCTCCACCTGCTGGA
TGTCCAGGGGAAGCAACAGAATAAGCACGTGTTCTTTTTTGACACCAAAAAGGAAGTTGAACAG
TTTGATGTTGCGACTCACTTGCAGACGGCCCCAGAACTACTCGATAGGGTCTATAATAGACCCA
GAATAGAGACCTTGCAGAAGGAGAGAGTGAAAGGAGTTACCCCTCAGACTCGCCTCAAGCGGAT
AGCCAAAGAACGACAAAAGCAGTATGACTGCTTGACACAGCGCATCGAGCGGGAGAAGCAGCTG
TTTGTTGTTGCCCAGAAAATCCAGACACGCAAAGACCTCATGGATAAAACTCAGAAGGTGAAGG
TGAAGAAAGAAACAGTAAACTCCCCAGCGATATACAGATTCCAGACTCGCCGGAAACGTTGATG
TCTTAAAAATCAGCCTCAGCAGTCTGTATGGAAAAGAATTCTTACCGTTTTCCTCCTTTCTTTT
GTAATAACTTCAGATTTTATTAGTCCAAAGGGCTCGGTCTTCCTCTTTTGTAATCATGGCTTAC
TGTCAACCCAGTACTTGACATCTTTCTATGAAAATAGTAAAGTCCCTCCCCAGTGTTATTGTCT
CTGTATTGATGAACTGAGCCTCTTACATAAGTACTTATGTTTGTCTAGGAGAGTTATATAATCT
CATGTAACAAAGTAGAAAATAGATGAATACATTCCATTCTCAGTATTAAGACAACTTATCTATT
CCATAGCAGGACCTAGGGCTACTGATGTGAGCGGCTACTGCAGGCATTCTGGTTTATGTTCCCC
GTTTGGGAGAGTTATACATTGGCTTTGTTTATAATTTTGTTTTGTCATTCTCCTTCTAGTAGAT
TTTATTCTAATTTTTAATTAAATCATTAGTTCTATTCCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101448	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68964	(Get FASTA)	NCBI Sequence Viewer
	EDL80398	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009882
GenBank Protein	Q8R5K5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001101448 ⟸ NM_001107978

- UniProtKB:

A0A8I5ZYE3 (UniProtKB/TrEMBL), A6IS47 (UniProtKB/TrEMBL), B5DF84 (UniProtKB/TrEMBL), F7EN70 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSAAFRKAAKTRQREHRERSQPGFRKRLGLLEKKKDYKLRANDYHKKQDFLRALRKKALEKNPD
EFYYKMTRAKLQDGVHIFKDNKEEVTAEQLKLMRTQDIKYIEMKRVAEAKKIERLKSELHLLDV
QGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELLDRVYNRPRIETLQKERVKGVTPQTRLKRIA
KERQKQYDCLTQRIEREKQLFVVAQKIQTRKDLMDKTQKVKVKKETVNSPAIYRFQTRRKR

hide sequence

Ensembl Acc Id:

ENSRNOP00000009882 ⟸ ENSRNOT00000009882

Ensembl Acc Id:

ENSRNOP00000083956 ⟸ ENSRNOT00000101405

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R5K5-F1-model_v2	AlphaFold	Q8R5K5	1-253	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694009

Promoter ID:

EPDNEW_R4534

Type:

initiation region

Name:

Utp11_1

Description:

UTP11, small subunit processome component

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	142,681,181 - 142,681,241	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621412	AgrOrtholog
BioCyc Gene	G2FUF-39959	BioCyc
Ensembl Genes	ENSRNOG00000007174	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000009882	ENTREZGENE
InterPro	SSU_processome_Utp11	UniProtKB/Swiss-Prot
NCBI Gene	Utp11	ENTREZGENE
PANTHER	PTHR12838	UniProtKB/Swiss-Prot
	U3 SMALL NUCLEOLAR RNA-ASSOCIATED PROTEIN 11-RELATED	UniProtKB/Swiss-Prot
Pfam	Utp11	UniProtKB/Swiss-Prot
PhenoGen	Utp11	PhenoGen
PIRSF	U3snoRNP11	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007174	RatGTEx
UniProt	A0A8I5ZYE3	ENTREZGENE
	A6IS47	ENTREZGENE, UniProtKB/TrEMBL
	B5DF84	ENTREZGENE
	F7EN70	ENTREZGENE, UniProtKB/TrEMBL
	Q8R5K5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-06-12	Utp11	UTP11, small subunit processome component	Utp11	UTP11, small subunit processome component homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-01	Utp11	UTP11, small subunit processome component homolog (S. cerevisiae)	Utp11l	UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-10-12	Utp11l	UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)	RGD1559610	similar to CGI-94 protein	Data merged from RGD:1559610	737654	APPROVED
2008-04-30	RGD1559610	similar to CGI-94 protein	RGD1559610_predicted	similar to CGI-94 protein (predicted)	'predicted' is removed	2292626	APPROVED
2008-02-19	Utp11l	UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)	Cgi94	comparative gene identification transcript 94	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1559610_predicted	similar to CGI-94 protein (predicted)	LOC313581	similar to CGI-94 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC313581	similar to CGI-94 protein			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-02-10	Cgi94	comparative gene identification transcript 94	Cgi-94	CGI-94 protein	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-08-07	Cgi-94	CGI-94 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to cytoplasm, extracelluar space and is translocated to the nucleus	632408
gene_function	interacts with second mitochondria-derived activator of caspases/Diablo	1299313
gene_physical_interaction	interacts with second mitochondria-derived activator of caspases/Diablo	632408
gene_process	may be a regulator of neuronal apoptosis	1299313

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message