Advanced Search (OLGA)

Gene: Cds1 (CDP-diacylglycerol synthase 1) Rattus norvegicus

Analyze

Symbol:

Cds1

Name:

CDP-diacylglycerol synthase 1

RGD ID:

621185

Description:

Enables phosphatidate cytidylyltransferase activity. Predicted to be involved in glycerophospholipid biosynthetic process; lipid droplet formation; and positive regulation of fat cell differentiation. Located in endoplasmic reticulum membrane. Orthologous to human CDS1 (CDP-diacylglycerol synthase 1); PARTICIPATES IN glycerophospholipid metabolic pathway; phosphatidylinositol 3-kinase signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CDP-DAG synthase 1; CDP-DG synthase 1; CDP-DG synthetase 1; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1; CDP-diglyceride pyrophosphorylase 1; CDP-diglyceride synthase 1; CDP-diglyceride synthetase 1; CDS 1; CTP:phosphatidate cytidylyltransferase 1; phosphatidate cytidylyltransferase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDS1 (CDP-diacylglycerol synthase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cds1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cds1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDS1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDS1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cds1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDS1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDS1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cds1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cds1 (CDP-diacylglycerol synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CDS2 (CDP-diacylglycerol synthase 2)	HGNC	OrthoDB
Homo sapiens (human):	ELK4 (ETS transcription factor ELK4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CDS1 (CDP-diacylglycerol synthase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cds1 (CDP-diacylglycerol synthase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cds1 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cds1 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cds	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdgs-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cds1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	8,126,678 - 8,187,243 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	8,124,838 - 8,187,218 (-)	Ensembl				GRCr8
mRatBN7.2	14	7,820,328 - 7,882,943 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	7,820,351 - 7,882,681 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	7,788,202 - 7,848,854 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	9,088,435 - 9,149,086 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	7,784,572 - 7,845,223 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	9,396,511 - 9,456,964 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	9,396,512 - 9,456,990 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	9,358,067 - 9,418,520 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	9,074,826 - 9,135,391 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	7,941,818 - 8,002,370 (-)	NCBI		Celera
RGSC_v3.1	14	9,072,988 - 9,135,335 (-)	NCBI
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

Chemical and Drug Induced Liver Injury (ISO)

Experimental Mammary Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acetylsalicylic acid (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

Butylbenzyl phthalate (EXP)

butyric acid (EXP)

calcitriol (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

coumestrol (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diquat (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

Enterolactone (ISO)

furan (EXP)

gentamycin (EXP)

hypochlorous acid (ISO)

indole-3-methanol (EXP)

iron atom (EXP)

iron(0) (EXP)

lead(0) (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methoxychlor (EXP)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (ISO)

nicotine (ISO)

ozone (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pravastatin (EXP,ISO)

propanal (ISO)

quercetin (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

CDP-diacylglycerol biosynthetic process (IBA,IEA,ISO,ISS)

lipid droplet formation (IBA,IEA,ISO,ISS)

lipid metabolic process (IEA)

phosphatidylinositol biosynthetic process (IEA,ISO,ISS)

phospholipid biosynthetic process (IEA)

positive regulation of fat cell differentiation (IEA,ISO,ISS)

Cellular Component

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum membrane (IBA,IDA,IEA)

membrane (IDA,IEA)

Molecular Function

nucleotidyltransferase activity (IEA)

phosphatidate cytidylyltransferase activity (IBA,IDA,IEA,ISO)

protein binding (ISO)

transferase activity (IEA)

transferase activity, transferring phosphorus-containing groups (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

glycerophospholipid metabolic pathway (IEA,ISO)

phosphatidylinositol 3-kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Mitochondrial CDP-diacylglycerol synthase activity is due to the peripheral protein, TAMM41 and not due to the integral membrane protein, CDP-diacylglycerol synthase 1.	Blunsom NJ, etal., Biochim Biophys Acta Mol Cell Biol Lipids. 2018 Mar;1863(3):284-298. doi: 10.1016/j.bbalip.2017.12.005. Epub 2017 Dec 16.
2.	Sustained phospholipase C stimulation of H9c2 cardiomyoblasts by vasopressin induces an increase in CDP-diacylglycerol synthase 1 (CDS1) through protein kinase C and cFos.	Blunsom NJ, etal., Biochim Biophys Acta Mol Cell Biol Lipids. 2019 Jul;1864(7):1072-1082. doi: 10.1016/j.bbalip.2019.03.002. Epub 2019 Mar 9.
3.	Mutations in CHEK2 associated with prostate cancer risk.	Dong X, etal., Am J Hum Genet 2003 Feb;72(2):270-80. Epub 2003 Jan 17.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Cloning of CDP-diacylglycerol synthase from a human neuronal cell line.	Heacock AM, etal., J Neurochem 1996 Nov;67(5):2200-3.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Mutations of the CHK2 gene are found in some osteosarcomas, but are rare in breast, lung, and ovarian tumors.	Miller CW, etal., Genes Chromosomes Cancer 2002 Jan;33(1):17-21.
9.	Extraction and stabilization of mammalian CDP-diacylglycerol synthase activity.	Monaco ME and Feldman M, Biochem Biophys Res Commun 1997 Oct 9;239(1):166-70.
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Gene cloning and characterization of CDP-diacylglycerol synthase from rat brain.	Saito S, etal., J Biol Chem 1997 Apr 4;272(14):9503-9.
18.	Variants in CHEK2 other than 1100delC do not make a major contribution to breast cancer susceptibility.	Schutte M, etal., Am J Hum Genet 2003 Apr;72(4):1023-8. Epub 2003 Feb 27.

Additional References at PubMed

PMID:6271231	PMID:9407135	PMID:12477932	PMID:16023307	PMID:25375833	PMID:26946540	PMID:31548309

Genomics

Comparative Map Data

Cds1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	8,126,678 - 8,187,243 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	8,124,838 - 8,187,218 (-)	Ensembl				GRCr8
mRatBN7.2	14	7,820,328 - 7,882,943 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	7,820,351 - 7,882,681 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	7,788,202 - 7,848,854 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	9,088,435 - 9,149,086 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	7,784,572 - 7,845,223 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	9,396,511 - 9,456,964 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	9,396,512 - 9,456,990 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	9,358,067 - 9,418,520 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	9,074,826 - 9,135,391 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	7,941,818 - 8,002,370 (-)	NCBI		Celera
RGSC_v3.1	14	9,072,988 - 9,135,335 (-)	NCBI
Cytogenetic Map	14	p22	NCBI

CDS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	84,583,127 - 84,651,334 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	84,582,879 - 84,651,334 (+)	Ensembl			hg38	GRCh38
GRCh37	4	85,504,280 - 85,572,487 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	85,723,081 - 85,789,379 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	85,861,235 - 85,927,518	NCBI
Celera	4	82,794,273 - 82,862,979 (+)	NCBI		Celera
Cytogenetic Map	4	q21.23	NCBI
HuRef	4	81,245,783 - 81,314,483 (+)	NCBI		HuRef
CHM1_1	4	85,481,027 - 85,549,447 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	87,913,124 - 87,981,319 (+)	NCBI		T2T-CHM13v2.0

Cds1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	101,913,001 - 101,971,724 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	101,912,996 - 101,971,724 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	101,765,093 - 101,823,858 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	101,765,130 - 101,823,858 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	102,194,149 - 102,252,871 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	102,005,432 - 102,064,154 (+)	NCBI		MGSCv36	mm8
Celera	5	99,089,034 - 99,148,175 (+)	NCBI		Celera
Cytogenetic Map	5	E5	NCBI
cM Map	5	48.93	NCBI

Cds1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955474	5,057,833 - 5,104,235 (-)	Ensembl
ChiLan1.0	NW_004955474	5,057,833 - 5,104,235 (-)	NCBI	ChiLan1.0	ChiLan1.0

CDS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	45,377,695 - 45,465,834 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	45,583,939 - 45,652,498 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	39,530,229 - 39,598,543 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	45,379,856 - 45,448,170 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	45,379,856 - 45,448,170 (-)	Ensembl			panPan2	panpan1.1

CDS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	8,349,033 - 8,416,451 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	8,349,027 - 8,415,295 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	33,471,474 - 33,538,922 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	8,368,977 - 8,436,435 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	8,368,291 - 8,434,285 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	8,450,173 - 8,517,750 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	8,310,109 - 8,377,532 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	31,580,775 - 31,648,217 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cds1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	3,998,516 - 4,065,872 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936738	160,338 - 227,775 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936738	160,346 - 227,687 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	133,959,247 - 134,041,258 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	133,959,250 - 134,041,258 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	143,439,806 - 143,520,073 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	32,947,644 - 33,014,807 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	32,948,053 - 33,014,944 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	11,575,377 - 11,648,722 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cds1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624900	1,701,522 - 1,766,768 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624900	1,701,507 - 1,765,791 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cds1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	11,941,624 - 12,004,217 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cds1
599 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	359
Count of miRNA genes:	195
Interacting mature miRNAs:	253
Transcripts:	ENSRNOT00000002918
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3957878	21572472	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3957878	24886169	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3957878	18558812	Rat
7411573	Bw139	Body weight QTL 139	4.7	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	14	1	40068101	Rat
9589814	Gluco67	Glucose level QTL 67	4.54	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	40068101	Rat
724541	Niddm53	Non-insulin dependent diabetes mellitus QTL 53		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	3957878	9393298	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3957878	31121464	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41415516	Rat
71115	Niddm15	Non-insulin dependent diabetes mellitus QTL 15	4.8		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	11334906	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	17877928	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1	31893212	Rat

Markers in Region

AU047981

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	7,831,930 - 7,832,228 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	9,406,273 - 9,406,570	NCBI	Rnor6.0
Rnor_5.0	14	9,367,829 - 9,368,126	UniSTS	Rnor5.0
RGSC_v3.4	14	9,084,588 - 9,084,885	UniSTS	RGSC3.4
Celera	14	7,951,580 - 7,951,877	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	86	59	6	350	186	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB009999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127492	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002918 ⟹ ENSRNOP00000002918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	8,124,860 - 8,187,187 (-)	Ensembl
mRatBN7.2 Ensembl	14	7,820,351 - 7,882,681 (-)	Ensembl
Rnor_6.0 Ensembl	14	9,396,512 - 9,456,990 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000141270 ⟹ ENSRNOP00000099347

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	8,124,838 - 8,187,218 (-)	Ensembl

RefSeq Acc Id:

NM_031242 ⟹ NP_112521

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	8,126,678 - 8,187,243 (-)	NCBI
mRatBN7.2	14	7,822,169 - 7,882,737 (-)	NCBI
Rnor_6.0	14	9,396,511 - 9,456,964 (-)	NCBI
Rnor_5.0	14	9,358,067 - 9,418,520 (-)	NCBI
RGSC_v3.4	14	9,074,826 - 9,135,391 (-)	RGD
Celera	14	7,941,818 - 8,002,370 (-)	RGD

Sequence:

show sequence

CGCGGCTCCGCGGTGGCGGGGCGCTAGTCGACGCCAGCCCAGCGACGCGAGAGCGGGACATGCT
GGAGCTGCGGCACCGCGGGGGCTGCCCCGGCCCCGGGGGAGCGGGGACGCCGCCACCCCGCGAG
GGAGAGGCGGCCGGCGGCGACCACGAAACCGAGAGCACCAGCGACAAAGAAACAGATATTGATG
ACAGGTATGGAGATCTCGATGCCAGAGGAGATTCCGATGTTCCTGAGGTCCCACCATCCTCAGA
CAGGACCCCCGAGATTCTCAAGAAAGCCCTGTCTGGACTGTCATCAAGATGGAAGAACTGGTGG
ATTCGTGGGATCCTCACCCTGACCATGATCTCCCTCTTCTTCCTGATCATCTATATGGGGTCCT
TCATGCTGATGCTTCTGGTTCTGGGCATCCAGGTGAAGTGCTTCCAGGAGATCATAACCATCGG
GTACAGGGTCTACCACTCCTACGACCTCCCGTGGTTTAGAACACTAAGTTGGTACTTCCTCCTA
TGTGTGAACTACTTCTTCTATGGAGAGACAGTGGCAGATTACTTCGCCACGTTCGTTCAGAGGG
AGGAGCAGCTGCAGTTCCTCATTCGCTACCACAGGTTCATATCCTTCGCCCTCTACCTGGCAGG
TTTCTGCATGTTCGTCCTGAGCTTGGTGAAGAAACACTACCGACTACAGTTCTATATGTTCGCA
TGGACTCACGTCACTTTACTGATAACCGTCACTCAGTCACATCTTGTCATCCAAAATCTGTTTG
AAGGCATGATATGGTTCCTTGTCCCCATATCAAGCGTCATCTGCAATGATATCACGGCTTACCT
TTTTGGATTTTTTTTTGGAAGAACTCCTTTAATTAAGCTGTCTCCTAAGAAGACCTGGGAAGGA
TTCATTGGTGGTTTCTTCTCCACAGTCATATTTGGATTCATTGCTGCCTATGTGTTGTCCAAGT
ATCAGTACTTTGTGTGCCCGGTGGAGTACCGAAGCGACGTCAACTCCTTCGTGACAGAATGTGA
GCCCTCAGAACTGTTCCAGCTTCAGAATTACTCCCTCCCTCCGTTCCTACAGGCAGTGCTGAGC
CGGGAGACCGTGAGCTTGTACCCCTTCCAGATACACAGCATTGCCCTTTCAACATTTGCATCAC
TGATCGGCCCATTCGGAGGCTTCTTCGCCAGTGGATTCAAAAGAGCTTTCAAAATCAAGGACTT
TGCAAACACTATTCCTGGGCATGGAGGGATAATGGACAGGTTCGATTGTCAGTATTTGATGGCG
ACGTTCGTGCACGTGTACATCACCAGCTTCATCAGGGGTCCGAATCCCAGCAAAGTGCTCCAGC
AGCTCCTAGTGCTTCAGCCAGAGCAGCAGTTAAACATCTACAGAACCCTGAAGATACATCTCAC
GGAGAAAGGCATCCTGCAGCCCACCTGGAAGGTGTAGCTGTCCTGAGGGGACAGACTGCTGAGG
AGGAAGGAGCTCACAGAGCAGCTCCGACTGAAGTCTTGCACTGAGCCAGCCTGGGGCTAGAAAC
TCAGTAGATGCAGGTTTTGCAGATACGAATGTTTCTCTTTCTCTGAAATTACTGTGAATATTTA
ACAAACACGAGATCTGAGACGAGTGCGCATCAGTCGCCGCCGTGAAAGATCCGTGCTTTTCTAA
GATGTATTTTCCAATGTTAAGTTCTCCGCCCTTACTGGCCGGGCTCCATGATGTAGGAGGTTTA
AAGAGTCAAGCACTGTCACCTGAGGCTGAGGCCCCCTTAGGCTCGTGCCTGGCAGTGTGATCCT
TCTCACAAACACTGACCTTTGCACTGACTGGGAGCTGCCTCTCTGTGGCTGGGGATGCTCAGCA
GGCACCCTGGGAAGCGAGGCCTAGGGCTTCCTCCTCTACTGACCTCAGGCATTTCTGCAGGCTG
AGTTAGATTAAAAAAGAAAGAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112521	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI27493	(Get FASTA)	NCBI Sequence Viewer
	BAA28787	(Get FASTA)	NCBI Sequence Viewer
	EDL99537	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002918
	ENSRNOP00000002918.3
GenBank Protein	O35052	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112521 ⟸ NM_031242

- UniProtKB:

A0JPL6 (UniProtKB/Swiss-Prot), O88208 (UniProtKB/Swiss-Prot), O35052 (UniProtKB/Swiss-Prot), A6K5W7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLELRHRGGCPGPGGAGTPPPREGEAAGGDHETESTSDKETDIDDRYGDLDARGDSDVPEVPPS
SDRTPEILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFQEIIT
IGYRVYHSYDLPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYL
AGFCMFVLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITA
YLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTE
CEPSELFQLQNYSLPPFLQAVLSRETVSLYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIK
DFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLNIYRTLKIH
LTEKGILQPTWKV

hide sequence

Ensembl Acc Id:

ENSRNOP00000002918 ⟸ ENSRNOT00000002918

Ensembl Acc Id:

ENSRNOP00000099347 ⟸ ENSRNOT00000141270

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35052-F1-model_v2	AlphaFold	O35052	1-461	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699185

Promoter ID:

EPDNEW_R9710

Type:

initiation region

Name:

Cds1_1

Description:

CDP-diacylglycerol synthase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	9,457,079 - 9,457,139	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621185	AgrOrtholog
BioCyc Gene	G2FUF-16446	BioCyc
BioCyc Pathway	PWY-5667 [CDP-diacylglycerol biosynthesis I]	BioCyc
BioCyc Pathway Image	PWY-5667	BioCyc
Ensembl Genes	ENSRNOG00000002142	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002918	ENTREZGENE
	ENSRNOT00000002918.7	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8373547	IMAGE-MGC_LOAD
InterPro	PC_trans	UniProtKB/Swiss-Prot
	PC_Trfase_euk	UniProtKB/Swiss-Prot
KEGG Report	rno:81925	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156628	IMAGE-MGC_LOAD
NCBI Gene	81925	ENTREZGENE
PANTHER	PHOSPHATIDATE CYTIDYLYLTRANSFERASE 1	UniProtKB/Swiss-Prot
	PTHR13773	UniProtKB/Swiss-Prot
Pfam	CTP_transf_1	UniProtKB/Swiss-Prot
PhenoGen	Cds1	PhenoGen
PIRSF	PC_trans_euk	UniProtKB/Swiss-Prot
PROSITE	CDS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002142	RatGTEx
UniProt	A0ABK0LDN0_RAT	UniProtKB/TrEMBL
	A0JPL6	ENTREZGENE
	A6K5W7	ENTREZGENE, UniProtKB/TrEMBL
	CDS1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	O88208	ENTREZGENE
UniProt Secondary	A0JPL6	UniProtKB/Swiss-Prot
	O88208	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-12-14	Cds1	CDP-diacylglycerol synthase 1		CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1	Name updated	1299863	APPROVED
2002-08-07	Cds1	CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways