Advanced Search (OLGA)

Gene: Psmb7 (proteasome 20S subunit beta 7) Rattus norvegicus

Analyze

Symbol:

Psmb7

Name:

proteasome 20S subunit beta 7

RGD ID:

621093

Description:

Predicted to enable endopeptidase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be part of proteasome core complex, beta-subunit complex. Predicted to be active in cytosol and nucleus. Orthologous to human PSMB7 (proteasome 20S subunit beta 7); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

beta-2; macropain chain Z; multicatalytic endopeptidase complex chain Z; proteasome (prosome, macropain) subunit, beta type 7; proteasome (prosome, macropain) subunit, beta type, 7; proteasome beta 7 subunit; proteasome subunit beta 7; proteasome subunit beta type-7; proteasome subunit beta-2; proteasome subunit Z; Z

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMB7 (proteasome 20S subunit beta 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Psmb7 (proteasome (prosome, macropain) subunit, beta type 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmb7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMB7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMB7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmb7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMB7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMB7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmb7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Psmb7 (proteasome 20S subunit beta 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PSMB7 (proteasome 20S subunit beta 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psmb7 (proteasome (prosome, macropain) subunit, beta type 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmb7 (proteasome subunit beta 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PUP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta2R1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Prosbeta2R2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	pbs-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psmb7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	psmb7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	42,767,500 - 42,827,470 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	42,767,501 - 42,827,601 (-)	Ensembl				GRCr8
mRatBN7.2	3	22,357,777 - 22,417,748 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	22,354,698 - 22,417,937 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	25,825,962 - 25,885,969 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	34,410,959 - 34,470,964 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	32,223,450 - 32,283,379 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	22,890,072 - 22,951,718 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	22,871,105 - 22,952,063 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	28,115,649 - 28,176,245 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	18,384,197 - 18,451,208 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	20,792,720 - 20,851,768 (-)	NCBI		Celera
RGSC_v3.1	3	18,280,569 - 18,347,580 (-)	NCBI
Cytogenetic Map	3	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Experimental Data Annotations Click to see Annotation Detail View

Vertebrate Trait

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Psmb7	Rat	coat/hair pigmentation trait		ISO	PSMB7 (Canis lupus familiaris)	9068941	Coat colour, harlequin	OMIA	PMID:18513894\|PMID:21256207\|PMID:31658272\|PMID:3270445\|PMID:34751460\|PMID:35510419\|PMID:3998446

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dimethoxyphenol (ISO)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlormequat chloride (EXP)

chloropicrin (ISO)

choline (ISO)

clobetasol (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

clozapine (ISO)

cobalt dichloride (EXP)

cocaine (EXP)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

furfural (ISO)

heparin (ISO)

inulin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lead(0) (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

nitrates (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

piperonyl butoxide (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

Salinomycin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

stattic (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tetrachloromethane (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valdecoxib (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteasomal protein catabolic process (IEA,ISO,NAS)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA,IEA,ISO)

proteolysis (IEA)

proteolysis involved in protein catabolic process (IEA)

regulation of proteasomal protein catabolic process (IEA,ISO)

response to oxidative stress (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IBA,IEA,ISO)

nuclear body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

proteasome complex (IEA,ISO)

proteasome core complex (IEA,ISO,ISS)

proteasome core complex, beta-subunit complex (IBA,ISS)

synaptic vesicle (NAS)

Molecular Function

endopeptidase activity (IBA)

hydrolase activity (IEA)

peptidase activity (IEA)

protein binding (ISO)

threonine-type endopeptidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

Experimental Data Annotations Click to see Annotation Detail View

Vertebrate Trait

coat/hair pigmentation trait (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The mouse genes encoding the third pair of beta-type proteasome subunits regulated reciprocally by IFN-gamma: structural comparison, chromosomal localization, and analysis of the promoter.	Hayashi M, etal., J Immunol 1997 Sep 15;159(6):2760-70.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	An abundance of free regulatory (19S) proteasome particles regulates neuronal synapses.	Sun C, etal., Science. 2023 May 26;380(6647):eadf2018. doi: 10.1126/science.adf2018. Epub 2023 May 26.

Additional References at PubMed

PMID:15489334	PMID:16857966	PMID:17323924	PMID:20498273	PMID:21630459	PMID:22793692	PMID:23106098	PMID:23376485	PMID:23969338	PMID:24270810

Genomics

Comparative Map Data

Psmb7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	42,767,500 - 42,827,470 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	42,767,501 - 42,827,601 (-)	Ensembl				GRCr8
mRatBN7.2	3	22,357,777 - 22,417,748 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	22,354,698 - 22,417,937 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	25,825,962 - 25,885,969 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	34,410,959 - 34,470,964 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	32,223,450 - 32,283,379 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	22,890,072 - 22,951,718 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	22,871,105 - 22,952,063 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	28,115,649 - 28,176,245 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	18,384,197 - 18,451,208 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	20,792,720 - 20,851,768 (-)	NCBI		Celera
RGSC_v3.1	3	18,280,569 - 18,347,580 (-)	NCBI
Cytogenetic Map	3	q12	NCBI

PSMB7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	124,353,465 - 124,415,442 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	124,352,999 - 124,415,476 (-)	Ensembl			hg38	GRCh38
GRCh37	9	127,115,744 - 127,177,721 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	126,155,565 - 126,217,542 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	124,195,298 - 124,257,275	NCBI
Celera	9	97,762,981 - 97,824,932 (-)	NCBI		Celera
Cytogenetic Map	9	q33.3	NCBI
HuRef	9	96,700,699 - 96,790,409 (-)	NCBI		HuRef
CHM1_1	9	127,264,760 - 127,326,757 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	136,551,512 - 136,613,496 (-)	NCBI		T2T-CHM13v2.0

Psmb7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	38,478,058 - 38,533,964 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	38,478,048 - 38,534,099 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	38,588,046 - 38,643,952 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	38,588,036 - 38,644,087 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	38,443,566 - 38,499,426 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	38,410,055 - 38,465,915 (-)	NCBI		MGSCv36	mm8
Celera	2	40,309,890 - 40,367,955 (-)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	24.42	NCBI

Psmb7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	3,706,226 - 3,761,780 (+)	Ensembl
ChiLan1.0	NW_004955419	3,706,273 - 3,761,603 (+)	NCBI	ChiLan1.0	ChiLan1.0

PSMB7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	14,939,086 - 15,001,084 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	14,941,435 - 15,003,430 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	95,475,378 - 95,540,314 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	123,995,678 - 124,057,491 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	123,995,678 - 124,057,483 (-)	Ensembl			panPan2	panpan1.1

PSMB7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	58,529,646 - 58,593,016 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	58,529,723 - 58,593,016 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	57,726,668 - 57,789,932 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	59,449,060 - 59,512,699 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	59,449,136 - 59,512,699 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	58,207,216 - 58,270,483 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	58,523,766 - 58,587,042 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	58,614,281 - 58,677,679 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Psmb7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	192,866,027 - 192,921,441 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	12,631,612 - 12,689,936 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	12,634,561 - 12,689,914 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMB7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	265,172,237 - 265,235,387 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	265,172,257 - 265,235,389 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	298,943,412 - 299,006,545 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMB7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	13,722,982 - 13,790,427 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	13,728,724 - 13,793,290 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666079	2,286,572 - 2,349,790 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmb7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	10,678,673 - 10,738,009 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624760	10,678,800 - 10,738,008 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Psmb7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	16,358,787 - 16,417,261 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Psmb7
235 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	110
Count of miRNA genes:	95
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000016876
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	29056275	47904329	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	body weight (CMO:0000012)	3	37772258	55937853	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	6125437	51125437	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	30832384	44921701	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	15272348	60272348	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	37796919	53640235	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
10450811	Scl73	Serum cholesterol level QTL 73	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat
10450808	Scl72	Serum cholesterol level QTL 72	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	38708931	67641995	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10450806	Scl71	Serum cholesterol level QTL 71	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	38708931	67641995	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	38708931	67641995	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	38708931	67641995	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	38708931	67641995	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	67641995	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	38708931	67641995	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	6556347	51556347	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	29056275	47904329	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	37796919	47904329	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	37796919	59119581	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat

Markers in Region

AU046771

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	22,403,188 - 22,403,429 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	22,935,507 - 22,935,747	NCBI	Rnor6.0
Rnor_5.0	3	28,160,783 - 28,161,023	UniSTS	Rnor5.0
RGSC_v3.4	3	18,429,802 - 18,430,042	UniSTS	RGSC3.4
Celera	3	20,838,040 - 20,838,280	UniSTS
Cytogenetic Map	3	q11	UniSTS

AA891777

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	2	1555.7	UniSTS
Cytogenetic Map	3	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF285103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212825	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213755	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016876 ⟹ ENSRNOP00000016876

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	22,890,203 - 22,951,711 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083850 ⟹ ENSRNOP00000069167

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	22,871,105 - 22,952,063 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085981 ⟹ ENSRNOP00000073989

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	42,767,501 - 42,827,601 (-)	Ensembl
mRatBN7.2 Ensembl	3	22,354,698 - 22,417,937 (-)	Ensembl
Rnor_6.0 Ensembl	3	22,890,073 - 22,951,718 (-)	Ensembl

RefSeq Acc Id:

NM_053532 ⟹ NP_445984

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	42,767,500 - 42,827,470 (-)	NCBI
mRatBN7.2	3	22,357,777 - 22,417,748 (-)	NCBI
Rnor_6.0	3	22,890,072 - 22,951,718 (-)	NCBI
Rnor_5.0	3	28,115,649 - 28,176,245 (-)	NCBI
RGSC_v3.4	3	18,384,197 - 18,451,208 (-)	RGD
Celera	3	20,792,720 - 20,851,768 (-)	RGD

Sequence:

show sequence

TGGGAAGATGGCGGCTGTGTCGGTGTTTCAGGCACCGGTCGGAGGCTTTTCTTTTGATAATTGC
CGCAGGAATGCGGTCTTGGAAGCTGATTTTGCAAAAAAGGGGTTCAAACTTCCGAAAGCTCGGA
AAACTGGCACTACCATCGCGGGGGTGGTCTATAAGGATGGAATAGTTCTTGGAGCAGACACGAG
AGCAACTGAAGGGATGGTTGTTGCTGACAAAAACTGTTCAAAAATTCACTTCATATCTCCTAAT
ATTTATTGCTGTGGTGCTGGGACAGCTGCAGACACAGACATGACAACCCAGCTTATTTCTTCTA
ACTTGGAGCTCCACTCTCTCACCACCGGCCGCCTTCCCAGAGTTGTCACAGCGAATCGGATGCT
GAAGCAGATGCTTTTCAGGTATCAAGGTTACATTGGTGCAGCCCTAGTTTTGGGGGGAGTCGAT
GTTACTGGACCTCATCTCTACAGCATCTATCCGCATGGATCAACTGATAAACTGCCTTATGTCA
CCATGGGTTCTGGCTCCTTGGCAGCAATGGCTGTGTTTGAAGATAAGTTTAGGCCAGATATGGA
GGAGGAAGAAGCCAAGAAGCTAGTGAGTGAAGCTATTGCAGCTGGCATCTTTAATGACTTGGGG
TCTGGAAGCAACATTGATCTGTGTGTTATCAGCAAGAGCAAGCTGGACTTTCTCCGTCCATACT
CAGTGCCCAACAAGAAAGGGACCAGGTTTGGCCGGTACAGGTGTGAGAAAGGCACTACCGCTGT
CCTCACGGAGAAAGTCACCCCTCTGGAGCTCGAGGTGCTAGAAGAGATTGTTCAGACAATGGAC
ACTTCGTGAATGGTGCTGCGGGCAGTTGGATAGCTCTCTGGGTGACTCGGTGTACATGCCACCC
CTGCCCCACCCCACTCTACCCCAATCAGAAAACATGCATTTGGCTATTGCTCAATTAAAACAAA
CCAGAAAACTTAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445984	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF97811	(Get FASTA)	NCBI Sequence Viewer
	AAH60551	(Get FASTA)	NCBI Sequence Viewer
	EDM00513	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073989
GenBank Protein	Q9JHW0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445984 ⟸ NM_053532

- UniProtKB:

Q9JHW0 (UniProtKB/Swiss-Prot), A0A8L2R849 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAVSVFQAPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRAT
EGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQ
MLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEE
EAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGTRFGRYRCEKGTTAVLT
EKVTPLELEVLEEIVQTMDTS

hide sequence

Ensembl Acc Id:

ENSRNOP00000016876 ⟸ ENSRNOT00000016876

Ensembl Acc Id:

ENSRNOP00000073989 ⟸ ENSRNOT00000085981

Ensembl Acc Id:

ENSRNOP00000069167 ⟸ ENSRNOT00000083850

Protein Domains

Proteasome beta subunit C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JHW0-F1-model_v2	AlphaFold	Q9JHW0	1-277	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692051

Promoter ID:

EPDNEW_R2576

Type:

multiple initiation site

Name:

Psmb7_1

Description:

proteasome subunit beta 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	22,951,725 - 22,951,785	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621093	AgrOrtholog
BioCyc Gene	G2FUF-49909	BioCyc
Ensembl Genes	ENSRNOG00000011732	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000085981	ENTREZGENE
Gene3D-CATH	3.60.20.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6922407	IMAGE-MGC_LOAD
InterPro	Ntn_hydrolases_N	UniProtKB/Swiss-Prot
	Pept_T1A_subB	UniProtKB/Swiss-Prot
	Proteasome_bsu_C	UniProtKB/Swiss-Prot
	Proteasome_bsu_CS	UniProtKB/Swiss-Prot
	Proteasome_sua/b	UniProtKB/Swiss-Prot
	Proteasome_suB-type	UniProtKB/Swiss-Prot
KEGG Report	rno:85492	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72743	IMAGE-MGC_LOAD
NCBI Gene	85492	ENTREZGENE
PANTHER	METALLOPROTEASE TLDD	UniProtKB/Swiss-Prot
	PROTEASOME SUBUNIT BETA TYPE-7	UniProtKB/Swiss-Prot
Pfam	Pr_beta_C	UniProtKB/Swiss-Prot
	Proteasome	UniProtKB/Swiss-Prot
PhenoGen	Psmb7	PhenoGen
PRINTS	PROTEASOME	UniProtKB/Swiss-Prot
PROSITE	PROTEASOME_BETA_1	UniProtKB/Swiss-Prot
	PROTEASOME_BETA_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011732	RatGTEx
Superfamily-SCOP	SSF56235	UniProtKB/Swiss-Prot
UniProt	A0A8L2R849	ENTREZGENE, UniProtKB/TrEMBL
	A6JEU7_RAT	UniProtKB/TrEMBL
	PSB7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	Psmb7	proteasome 20S subunit beta 7	Psmb7	proteasome subunit beta 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-08-19	Psmb7	proteasome subunit beta 7	Psmb7	proteasome (prosome, macropain) subunit, beta type 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Psmb7	proteasome (prosome, macropain) subunit, beta type 7		proteasome (prosome, macropain) subunit, beta type, 7	Name updated	1299863	APPROVED
2002-08-07	Psmb7	proteasome (prosome, macropain) subunit, beta type, 7			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)