Advanced Search (OLGA)

Gene: Ppp1r14a (protein phosphatase 1, regulatory (inhibitor) subunit 14A) Rattus norvegicus

Analyze

Symbol:

Ppp1r14a

Name:

protein phosphatase 1, regulatory (inhibitor) subunit 14A

RGD ID:

620536

Description:

Predicted to enable protein serine/threonine phosphatase inhibitor activity. Predicted to act upstream of or within cellular response to xenobiotic stimulus. Predicted to be located in cytoplasm. Orthologous to human PPP1R14A (protein phosphatase 1 regulatory inhibitor subunit 14A); INTERACTS WITH (R)-noradrenaline; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

17 kDa PKC-potentiated inhibitory protein of PP1; CPI-17; Cpi17; protein kinase C-potentiated inhibitor protein of 17 kDa; protein phosphatase 1 regulatory subunit 14A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,708,269 - 93,718,218 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	93,708,218 - 93,719,147 (+)	Ensembl				GRCr8
mRatBN7.2	1	84,583,127 - 84,590,743 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	84,586,627 - 84,590,671 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	89,998,058 - 90,002,196 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	98,457,866 - 98,462,002 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,753,902 - 91,758,040 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	87,224,683 - 87,232,842 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	87,224,677 - 87,232,848 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	88,402,435 - 88,411,822 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	84,421,638 - 84,427,235 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	78,973,128 - 78,977,227 (+)	NCBI		Celera
RGSC_v3.1	1	84,499,748 - 84,505,347 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colorectal Neoplasms (ISO)

Mesothelioma (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-noradrenaline (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetylcholine (EXP)

acrolein (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

beclomethasone (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

buspirone (EXP)

butanal (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chelerythrine (EXP)

choline (ISO)

cisplatin (ISO)

Cuprizon (EXP)

dextran sulfate (ISO)

diuron (EXP)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

erianin (ISO)

flavonoids (EXP)

folic acid (ISO)

FR900359 (ISO)

geranylgeraniol (EXP)

glafenine (EXP)

L-methionine (ISO)

levofloxacin (EXP)

metacetamol (ISO)

methamphetamine (EXP)

methylmercury chloride (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylephrine (EXP)

phorbol 12,13-dibutanoate (EXP)

potassium dichromate (ISO)

prednisolone (EXP)

progesterone (ISO)

propiconazole (ISO)

Ro 31-8220 (EXP)

SB 431542 (ISO)

simvastatin (EXP)

sunitinib (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (EXP,ISO)

trovafloxacin (EXP)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to xenobiotic stimulus (ISO)

Cellular Component

cytoplasm (IEA)

membrane (IEA)

nucleoplasm (ISO)

Molecular Function

protein binding (ISO)

protein phosphatase inhibitor activity (IEA,TAS)

protein serine/threonine phosphatase inhibitor activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phosphorylation of the myosin phosphatase inhibitors, CPI-17 and PHI-1, by integrin-linked kinase.	Deng JT, etal., Biochem J 2002 Oct 15;367(Pt 2):517-24.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Identification of a prognostic 5-Gene expression signature for gastric cancer.	Hou JY, etal., J Cancer Res Clin Oncol. 2017 Apr;143(4):619-629. doi: 10.1007/s00432-016-2324-z. Epub 2016 Dec 29.
4.	Identification of human, mouse and rat PPP1R14A, protein phosphatase-1 inhibitor subunit 14A, & mapping human PPP1R14A to chromosome 19q13.13-q13.2.	Li Z, etal., Mol Biol Rep 2001;28(2):91-101.
5.	GBPI, a novel gastrointestinal- and brain-specific PP1-inhibitory protein, is activated by PKC and inactivated by PKA.	Liu QR, etal., Biochem J 2004 Jan 1;377(Pt 1):171-81.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Phosphorylation of CPI17 and myosin binding subunit of type 1 protein phosphatase by p21-activated kinase.	Takizawa N, etal., Biochem Biophys Res Commun 2002 Oct 4;297(4):773-8.

Additional References at PubMed

PMID:16267107	PMID:17071121	PMID:18524939	PMID:19373133	PMID:19437030	PMID:19842549	PMID:20046026	PMID:20086008	PMID:22004286	PMID:22275376	PMID:22538237	PMID:23541585
PMID:24909118	PMID:25502873	PMID:28717991	PMID:38474189

Genomics

Comparative Map Data

Ppp1r14a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,708,269 - 93,718,218 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	93,708,218 - 93,719,147 (+)	Ensembl				GRCr8
mRatBN7.2	1	84,583,127 - 84,590,743 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	84,586,627 - 84,590,671 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	89,998,058 - 90,002,196 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	98,457,866 - 98,462,002 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,753,902 - 91,758,040 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	87,224,683 - 87,232,842 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	87,224,677 - 87,232,848 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	88,402,435 - 88,411,822 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	84,421,638 - 84,427,235 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	78,973,128 - 78,977,227 (+)	NCBI		Celera
RGSC_v3.1	1	84,499,748 - 84,505,347 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

PPP1R14A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	38,251,237 - 38,256,374 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	38,251,237 - 38,256,557 (-)	Ensembl			hg38	GRCh38
GRCh37	19	38,741,877 - 38,747,014 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	43,433,717 - 43,439,012 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	43,433,718 - 43,439,012	NCBI
Celera	19	35,544,117 - 35,549,412 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	35,189,903 - 35,195,254 (-)	NCBI		HuRef
CHM1_1	19	38,742,221 - 38,747,575 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	41,053,408 - 41,058,545 (-)	NCBI		T2T-CHM13v2.0

Ppp1r14a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	28,988,732 - 28,992,817 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	28,988,733 - 28,993,226 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	29,289,320 - 29,293,390 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	29,289,308 - 29,293,801 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	30,074,339 - 30,078,409 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	28,998,080 - 29,002,150 (+)	NCBI		MGSCv36	mm8
Celera	7	23,860,386 - 23,864,456 (+)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	16.94	NCBI

Ppp1r14a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	1,174,961 - 1,179,207 (+)	Ensembl
ChiLan1.0	NW_004955468	1,174,946 - 1,179,289 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP1R14A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	44,537,685 - 44,543,133 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	46,408,369 - 46,413,721 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	35,340,934 - 35,346,287 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	43,913,749 - 43,925,768 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

PPP1R14A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	114,739,823 - 114,743,663 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	114,740,117 - 114,741,910 (+)	Ensembl			canFam3	CanFam3.1
ROS_Cfam_1.0	1	115,339,382 - 115,344,306 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	115,339,397 - 115,347,869 (+)	Ensembl				ROS_Cfam_1.0 Ensembl

Ppp1r14a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	12,862,890 - 12,866,926 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936801	1,028,105 - 1,032,282 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936801	1,028,246 - 1,038,093 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP1R14A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	47,167,118 - 47,174,091 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	47,167,105 - 47,174,299 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	42,669,944 - 42,674,708 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP1R14A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	32,890,160 - 32,895,267 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	32,889,287 - 32,895,017 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	10,833,635 - 10,838,756 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp1r14a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	11,729,086 - 11,733,662 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	11,728,660 - 11,733,704 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ppp1r14a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	166,658,321 - 166,662,724 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ppp1r14a
58 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	65
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000028070
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat

Markers in Region

RH143064

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	1	841.9	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	155	91	90	59	72	59	6	336	172	11	131	81	92	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF352572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY050673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028070 ⟹ ENSRNOP00000028070

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	93,708,218 - 93,718,146 (+)	Ensembl
mRatBN7.2 Ensembl	1	84,586,627 - 84,590,671 (+)	Ensembl
Rnor_6.0 Ensembl	1	87,224,677 - 87,232,848 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000171120 ⟹ ENSRNOP00000101169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	93,708,218 - 93,719,147 (+)	Ensembl

RefSeq Acc Id:

NM_130403 ⟹ NP_569087

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,714,102 - 93,718,218 (+)	NCBI
mRatBN7.2	1	84,586,627 - 84,590,743 (+)	NCBI
Rnor_6.0	1	87,228,581 - 87,232,842 (+)	NCBI
Rnor_5.0	1	88,402,435 - 88,411,822 (+)	NCBI
RGSC_v3.4	1	84,421,638 - 84,427,235 (+)	RGD
Celera	1	78,973,128 - 78,977,227 (+)	RGD

Sequence:

show sequence

GGCACGAGGACGGACGACGGCGTGATGGCAGCGCAGCGGCTGGGCAAGCGCGTGCTGAGCAAGC
TGCAGTCCCCTTCGCGTGCCCGCGGCCCGGGGGGCAGCCCTAGTGGGCTGCAGAAGCGGCACGC
GCGAGTCACCGTCAAATACGACCGGCGAGAGCTGCAGCGGCGACTGGACGTGGAGAAGTGGATC
GACGGACGCTTGGAAGAGCTGTACCGCGGCAGGGAGGCAGACATGCCAGATGAGGTCAACATCG
ACGAGCTGCTGGAATTGGACAGTGAGGAGGAAAGATGCCGGAAAATCCGGGGACTCTTGGAGGC
TTGCCTGAATCCCACAGAGGACTTCGTCCAGGAGCTATTGGCCAAGCTTCGGGGCCTGCACAAG
CAGCCGGGCTTCCCGCAGCCCAGCCCCTCAGATGACCCCAGCCTGAGCCCCCGCCAGGACCCGG
CTCACACTGCTCCACCGTGACTGCGCCCGCCTCTGCTCCACCCCCAAAGCCCAGATTGTTTCTA
AGTTGTATTTAATGGTTCCGTAACTGGCAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017588644 ⟹ XP_017444133

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,708,270 - 93,718,218 (+)	NCBI
mRatBN7.2	1	84,583,473 - 84,590,743 (+)	NCBI
Rnor_6.0	1	87,224,683 - 87,232,842 (+)	NCBI

Sequence:

show sequence

ATCGGATCTCTCAGTGAACCTCGATCTAGGACCCAGAGGTCGAAGCCTGCACATTAGCCTGCAC
GTCTCTGTAGGAAGGGAAACTGAGGCCCGCTGGTCGGAGTGGGGCGGGTCCCAGAACACGAGCC
CCCGCCCCCGGTGGCCCCGCCCCACCCCGGCCCGTTAGAGACCCAAGCGCAAGACAGAGCGTAA
AGTGCAGACAGCGGACGGCGGCGTGATGGCAGCGCAGCGGCTGGGCAAGCGCGTGCTGAGCAAG
CTGCAGTCCCCTTCGCGTGCCCGCGGCCCGGGGGGCAGCCCTAGTGGGCTGCAGAAGCGGCACG
CGCGAGTCACCGTCAAATACGACCGGCGAGAGCTGCAGCGGCGACTGGACGTGGAGAAGTGGAT
CGACGGACGCTTGGAAGAGCTGTACCGCGGCAGGGAGGCAGACATGCCAGATGAGGTCAACATC
GACGAGCTGCTGGAATTGGACAGTGAGGAGGAAAGATGCCGGAAAATCCGGGGACTCTTGGAGG
CTTGCCTGAATCCCACAGAGGACTTCGTCCAGGAGCTATTGGCCAAGCTTCGGGGCCTGCACAA
GCAGCCGGGCTTCCCGCAGCCCAGCCCCTCAGATGACCCCAGCCTGAGCCCCCGCCAGGACCCG
GCTCACACTGCTCCACCGTGACTGCGCCCGCCTCTGCTCCACCCCCAAAGCCCAGATTGTTTCT
AAGTTGTATTTAATGGTTCCGTAACTGGC

hide sequence

RefSeq Acc Id:

XM_063261307 ⟹ XP_063117377

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,708,269 - 93,718,218 (+)	NCBI

RefSeq Acc Id:

XM_063261318 ⟹ XP_063117388

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,710,312 - 93,718,218 (+)	NCBI

RefSeq Acc Id:

XM_063261331 ⟹ XP_063117401

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,708,319 - 93,718,218 (+)	NCBI

RefSeq Acc Id:

XM_063261338 ⟹ XP_063117408

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,708,269 - 93,718,218 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_569087	(Get FASTA)	NCBI Sequence Viewer
	XP_017444133	(Get FASTA)	NCBI Sequence Viewer
	XP_063117377	(Get FASTA)	NCBI Sequence Viewer
	XP_063117388	(Get FASTA)	NCBI Sequence Viewer
	XP_063117401	(Get FASTA)	NCBI Sequence Viewer
	XP_063117408	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK35213	(Get FASTA)	NCBI Sequence Viewer
	AAL25831	(Get FASTA)	NCBI Sequence Viewer
	EDM07829	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000101169
GenBank Protein	Q99MC0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_569087 ⟸ NM_130403
- UniProtKB:	Q99MC0 (UniProtKB/Swiss-Prot), A6J9Q5 (UniProtKB/TrEMBL), A0A8L2QF19 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELY RGREADMPDEVNIDELLELDSEEERCRKIRGLLEACLNPTEDFVQELLAKLRGLHKQPGFPQPS PSDDPSLSPRQDPAHTAPP hide sequence

RefSeq Acc Id:	XP_017444133 ⟸ XM_017588644
- Peptide Label:	isoform X1
- UniProtKB:	Q99MC0 (UniProtKB/Swiss-Prot), A6J9Q5 (UniProtKB/TrEMBL), A0A8L2QF19 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELY RGREADMPDEVNIDELLELDSEEERCRKIRGLLEACLNPTEDFVQELLAKLRGLHKQPGFPQPS PSDDPSLSPRQDPAHTAPP hide sequence

Ensembl Acc Id:

ENSRNOP00000028070 ⟸ ENSRNOT00000028070

RefSeq Acc Id:	XP_063117408 ⟸ XM_063261338
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063117377 ⟸ XM_063261307
- Peptide Label:	isoform X1
- UniProtKB:	Q99MC0 (UniProtKB/Swiss-Prot), A6J9Q5 (UniProtKB/TrEMBL), A0A8L2QF19 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117401 ⟸ XM_063261331
- Peptide Label:	isoform X1
- UniProtKB:	Q99MC0 (UniProtKB/Swiss-Prot), A6J9Q5 (UniProtKB/TrEMBL), A0A8L2QF19 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117388 ⟸ XM_063261318
- Peptide Label:	isoform X1
- UniProtKB:	Q99MC0 (UniProtKB/Swiss-Prot), A6J9Q5 (UniProtKB/TrEMBL), A0A8L2QF19 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000101169 ⟸ ENSRNOT00000171120

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99MC0-F1-model_v2	AlphaFold	Q99MC0	1-147	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689894

Promoter ID:

EPDNEW_R419

Type:

multiple initiation site

Name:

Ppp1r14a_1

Description:

protein phosphatase 1, regulatory subunit 14A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	87,228,573 - 87,228,633	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620536	AgrOrtholog
BioCyc Gene	G2FUF-60183	BioCyc
Ensembl Genes	ENSRNOG00000020676	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000171120	ENTREZGENE
Gene3D-CATH	1.10.150.220	UniProtKB/Swiss-Prot
InterPro	CPI-17	UniProtKB/Swiss-Prot
	CPI-17_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:114004	UniProtKB/Swiss-Prot
NCBI Gene	114004	ENTREZGENE
PANTHER	PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 14A	UniProtKB/Swiss-Prot
	PTHR16188	UniProtKB/Swiss-Prot
Pfam	PP1_inhibitor	UniProtKB/Swiss-Prot
PhenoGen	Ppp1r14a	PhenoGen
RatGTEx	ENSRNOG00000020676	RatGTEx
Superfamily-SCOP	SSF81790	UniProtKB/Swiss-Prot
UniProt	A0A8L2QF19	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LD19_RAT	UniProtKB/TrEMBL
	A6J9Q5	ENTREZGENE, UniProtKB/TrEMBL
	PP14A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Ppp1r14a	protein phosphatase 1, regulatory (inhibitor) subunit 14A		protein phosphatase 1, regulatory (inhibitor) subunit 14a	Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Ppp1r14a				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in smooth muscle tissues and brain	633337
gene_protein	phosphorylation at Thr38 signiﬁcantly enhances the inhibitory activity	633337
gene_regulation	phosphorylated by p21-activated protein kinase (PAK)	633337

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD