Advanced Search (OLGA)

Gene: Syt10 (synaptotagmin 10) Rattus norvegicus

Analyze

Symbol:

Syt10

Name:

synaptotagmin 10

RGD ID:

62041

Description:

Predicted to enable several functions, including calcium ion sensor activity; phospholipid binding activity; and protein dimerization activity. Predicted to be involved in positive regulation of calcium ion-dependent exocytosis; presynaptic dense core vesicle exocytosis; and sensory perception of smell. Predicted to be located in synaptic vesicle membrane. Predicted to be active in several cellular components, including exocytic vesicle; glutamatergic synapse; and presynapse. Orthologous to human SYT10 (synaptotagmin 10); INTERACTS WITH 17beta-estradiol; ammonium chloride; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

synaptotagmin X; synaptotagmin-10; sytX

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SYT10 (synaptotagmin 10)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Syt10 (synaptotagmin X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SYT10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Syt10 (synaptotagmin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Syt10 (synaptotagmin X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SYT10 (synaptotagmin 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	syt10 (synaptotagmin X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snt-5	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	syt10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,737,301 - 122,800,462 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	122,648,419 - 122,800,462 (-)	Ensembl				GRCr8
mRatBN7.2	7	120,857,698 - 120,920,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,862,972 - 120,920,863 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	122,661,274 - 122,718,960 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,887,410 - 124,945,103 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,819,888 - 124,879,596 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,769,039 - 130,827,030 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,768,841 - 130,827,152 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	130,452,003 - 130,510,388 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	128,115,443 - 128,174,355 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	117,334,018 - 117,391,703 (-)	NCBI		Celera
RGSC_v3.1	7	128,149,672 - 128,208,585 (-)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Seizures (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-estradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chrysene (ISO)

cocaine (EXP)

dibutyl phthalate (EXP)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

glufosinate (ISO)

graphene oxide (ISO)

methamphetamine (EXP,ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (ISO)

PCB138 (ISO)

potassium dichromate (ISO)

tetraphene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chemical synaptic transmission (IBA,ISO,ISS)

exocytosis (IEA)

positive regulation of calcium ion-dependent exocytosis (ISO,ISS)

presynaptic dense core vesicle exocytosis (ISO)

regulation of calcium ion-dependent exocytosis (IBA,ISO)

sensory perception of smell (ISO,ISS)

synaptic vesicle exocytosis (ISO,ISS)

vesicle-mediated transport (IBA)

Cellular Component

cytoplasmic vesicle (IEA)

exocytic vesicle (IBA,ISO,ISS)

glutamatergic synapse (ISO)

membrane (IEA)

plasma membrane (IBA)

presynapse (ISO)

synaptic vesicle membrane (TAS)

transport vesicle membrane (IEA)

Molecular Function

calcium ion binding (ISO,ISS)

calcium ion sensor activity (IBA)

calcium-dependent phospholipid binding (IBA)

identical protein binding (ISO)

metal ion binding (IEA)

phosphatidylinositol-4,5-bisphosphate binding (ISO)

phosphatidylserine binding (ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

SNARE binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A novel seizure-induced synaptotagmin gene identified by differential display.	Babity JM, etal., Proc Natl Acad Sci U S A 1997 Mar 18;94(6):2638-41.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10531343	PMID:10531344	PMID:12860971	PMID:21496647

Genomics

Comparative Map Data

Syt10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,737,301 - 122,800,462 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	122,648,419 - 122,800,462 (-)	Ensembl				GRCr8
mRatBN7.2	7	120,857,698 - 120,920,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,862,972 - 120,920,863 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	122,661,274 - 122,718,960 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,887,410 - 124,945,103 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,819,888 - 124,879,596 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,769,039 - 130,827,030 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,768,841 - 130,827,152 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	130,452,003 - 130,510,388 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	128,115,443 - 128,174,355 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	117,334,018 - 117,391,703 (-)	NCBI		Celera
RGSC_v3.1	7	128,149,672 - 128,208,585 (-)	NCBI
Cytogenetic Map	7	q34	NCBI

SYT10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	33,374,238 - 33,439,819 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	33,374,238 - 33,439,819 (-)	Ensembl			hg38	GRCh38
GRCh37	12	33,527,173 - 33,592,754 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	33,419,615 - 33,484,021 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	33,419,614 - 33,484,021	NCBI
Celera	12	13,335,630 - 13,400,035 (-)	NCBI		Celera
Cytogenetic Map	12	p11.1	NCBI
HuRef	12	33,268,030 - 33,332,379 (-)	NCBI		HuRef
CHM1_1	12	33,493,388 - 33,557,762 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	33,245,435 - 33,311,036 (-)	NCBI		T2T-CHM13v2.0

Syt10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	89,657,221 - 89,726,181 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	89,666,596 - 89,726,063 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	89,773,714 - 89,841,980 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	89,782,393 - 89,841,860 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	89,612,824 - 89,672,291 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	89,610,160 - 89,669,536 (-)	NCBI		MGSCv36	mm8
Celera	15	91,906,236 - 91,966,102 (-)	NCBI		Celera
Cytogenetic Map	15	E3	NCBI
cM Map	15	44.96	NCBI

Syt10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955505	2,403,055 - 2,449,528 (+)	Ensembl
ChiLan1.0	NW_004955505	2,392,086 - 2,449,528 (+)	NCBI	ChiLan1.0	ChiLan1.0

SYT10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	63,284,958 - 63,358,857 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	63,286,586 - 63,355,247 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	52,761,294 - 52,830,221 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	55,364,858 - 55,429,298 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	55,364,714 - 55,429,298 (+)	Ensembl			panPan2	panpan1.1

SYT10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	15,593,709 - 15,657,184 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	15,593,649 - 15,687,920 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	30,768,616 - 30,835,595 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	15,771,897 - 15,835,539 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	15,771,596 - 15,866,288 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	15,579,522 - 15,646,934 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	15,608,782 - 15,676,039 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	30,916,635 - 30,980,314 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Syt10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	76,107,495 - 76,166,270 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936607	2,940,466 - 2,994,344 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936607	2,940,607 - 2,995,178 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SYT10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	40,872,283 - 40,934,326 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	40,869,418 - 40,940,851 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	43,998,608 - 44,061,673 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SYT10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	32,846,425 - 32,914,946 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	32,850,902 - 32,914,464 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666069	1,957,798 - 2,024,004 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Syt10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624778	2,700,545 - 2,763,134 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Syt10
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	259,074,353 - 259,139,068 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Syt10
625 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	12
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000019406
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	121393075	137014596	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	119280025	135560836	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
1582240	Sffal1	Serum free fatty acids level QTL 1	3.4	0.0021	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	7	118556868	125929417	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	116269196	132020414	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

D7Got235

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	122,760,247 - 122,760,490 (+)	Marker Load Pipeline
Rnor_6.0	7	130,786,157 - 130,786,399	NCBI	Rnor6.0
Rnor_5.0	7	130,469,515 - 130,469,757	UniSTS	Rnor5.0
RGSC_v3.4	7	128,132,749 - 128,132,991	UniSTS	RGSC3.4
Celera	7	117,351,660 - 117,351,902	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
7	4	7	126	28	25	14	5	14	2	95	26	11	115	45	79	11	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF375463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ437524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U85513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019406 ⟹ ENSRNOP00000019406

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	122,744,600 - 122,800,462 (-)	Ensembl
mRatBN7.2 Ensembl	7	120,864,997 - 120,920,863 (-)	Ensembl
Rnor_6.0 Ensembl	7	130,768,841 - 130,827,152 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098923 ⟹ ENSRNOP00000091005

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	122,648,419 - 122,800,462 (-)	Ensembl
mRatBN7.2 Ensembl	7	120,862,972 - 120,920,863 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172684 ⟹ ENSRNOP00000109467

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	122,737,301 - 122,800,462 (-)	Ensembl

RefSeq Acc Id:

NM_031666 ⟹ NP_113854

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,737,301 - 122,800,462 (-)	NCBI
mRatBN7.2	7	120,857,698 - 120,920,863 (-)	NCBI
Rnor_6.0	7	130,769,039 - 130,827,030 (-)	NCBI
Rnor_5.0	7	130,452,003 - 130,510,388 (-)	NCBI
RGSC_v3.4	7	128,115,443 - 128,174,355 (-)	RGD
Celera	7	117,334,018 - 117,391,703 (-)	RGD

Sequence:

show sequence

ATGAGTTTCCGCAAGGAGGACGGGGTGAGCAGCCTGTGCCAGAAGGCGCTGCACATCATCACCG
AGCTGTGCTTCGCGGGCCAGGTGGAGTGGGACAAGTGTTCGGGCATCTTTCCAGCCGATAGGAG
CGGCCAGGGCGGAGGTGGCACAGACATTTCAGTCAGCCTGTTAGCAGTTGTTGTAAGCTTCTGT
GGCCTGGCCCTGCTGGTTGTCTCCCTTTTCGTCTTCTGGAAGTTGTGCTGGCCCTGCTGGAAGA
GCAAGCTCGTGGCCCCCAATGTCAGTACCCTTCCGCAGAGCATCTCAAGTGCTCCAACTGAGGT
TTTTGAGACCGAAGAGAAAAAAGAAGTCGAAGAAAATGAAAAGCCAGCACCAAAAGCTATTGAG
CCTGCAATAAAAATCAGCCACACATCCCCCGACATCCCAGCAGAAGTGCAAACTGCTTTAAAGG
AGCATTTAATTAAACATGCCCGTGTGCAGAGGCAAACGACCGATCCTACATCTTCATCCCGCCA
CAATTCCTTCAGGAGGCACCTACCAAGGCAAATGAACGTCTCCAGTGTTGACTTTAGCATGGGC
ACGGAACCTGTCTTACAAAGAGGAGAAACCAGAACCAGCATCGGGAGGATAAAACCGGAACTCT
ATAAGCAGAAATCAGTTGACTCCGAGGGCAACAGAAAAGACGACGTCAAAACCTGTGGGAAACT
TAACTTTGCGCTCCAGTACGATTATGAAAATGAACTCCTAGTTGTTAAAATTATCAAAGCTCTA
GATCTCCCAGCTAAAGATTTCACAGGAACTTCTGATCCTTATGTGAAGATCTATCTTCTTCCGG
ACAGGAAGAAGAAATTTCAGACCCGTGTGCACCGGAAGACTTTAAACCCTCTGTTCGATGAGCT
ATTTCAGTTCCCGGTGGTTTACGATCAGCTAAGCAACCGCAAATTACACTTTAGTATATATGAT
TTTGACAGATTTTCCAGACACGACATGATTGGGGAAGTGATTCTTGATAATTTATTTGAAGTCT
CTGATCTCTCCAGGGAAGCCACAGTATGGAAAGATATCCACTGTGCAACCACAGAAAGCATAGA
CCTGGGCGAAATCATGTTTTCCCTTTGCTATTTGCCAACTGCTGGTCGCATGACCTTGACTGTG
ATCAAGTGCAGAAATCTGAAGGCAATGGACATTACCGGATCATCAGATCCTTATGTCAAAGTGT
CTCTGATGTGTGAGGGCCGAAGACTTAAAAAAAGAAAAACAACTACAAAGAAAAATACTCTCAA
TCCCGTGTACAATGAAGCCATTATTTTCGATATCCCTCCAGAAAATGTGGACCAGGTCAGCCTG
TGCATTGCGGTCATGGATTATGACAGGGTGGGACACAATGAGGTCATAGGTGTGTGTCGAACTG
GACTTGACGCTGAGGGTCTTGGAAGAGACCATTGGAATGAAATGCTGGCCTATCACCGAAAGCC
AATCACACACTGGCACCCCTTGCTGGAGTTACCTGGCCGAGCAACCAGTTTTGACAGTCAAGGA
TCCTGTTCTTCTCCCAGGCCACCGTCCACACCATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113854	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB51686	(Get FASTA)	NCBI Sequence Viewer
	AAK56958	(Get FASTA)	NCBI Sequence Viewer
	ABD83941	(Get FASTA)	NCBI Sequence Viewer
	EDL76586	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000091005.1
	ENSRNOP00000109467
GenBank Protein	O08625	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113854 ⟸ NM_031666

- UniProtKB:

Q925B8 (UniProtKB/Swiss-Prot), O08625 (UniProtKB/Swiss-Prot), A6K7P3 (UniProtKB/TrEMBL), Q1W5B9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSFRKEDGVSSLCQKALHIITELCFAGQVEWDKCSGIFPADRSGQGGGGTDISVSLLAVVVSFC
GLALLVVSLFVFWKLCWPCWKSKLVAPNVSTLPQSISSAPTEVFETEEKKEVEENEKPAPKAIE
PAIKISHTSPDIPAEVQTALKEHLIKHARVQRQTTDPTSSSRHNSFRRHLPRQMNVSSVDFSMG
TEPVLQRGETRTSIGRIKPELYKQKSVDSEGNRKDDVKTCGKLNFALQYDYENELLVVKIIKAL
DLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVHRKTLNPLFDELFQFPVVYDQLSNRKLHFSIYD
FDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTV
IKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSL
CIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRKPITHWHPLLELPGRATSFDSQG
SCSSPRPPSTP

hide sequence

Ensembl Acc Id:

ENSRNOP00000019406 ⟸ ENSRNOT00000019406

Ensembl Acc Id:

ENSRNOP00000091005 ⟸ ENSRNOT00000098923

Ensembl Acc Id:

ENSRNOP00000109467 ⟸ ENSRNOT00000172684

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O08625-F1-model_v2	AlphaFold	O08625	1-523	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:62041	AgrOrtholog
BioCyc Gene	G2FUF-32417	BioCyc
Ensembl Genes	ENSRNOG00000014296	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000098923.1	UniProtKB/Swiss-Prot
	ENSRNOT00000172684	ENTREZGENE
Gene3D-CATH	2.60.40.150	UniProtKB/Swiss-Prot
InterPro	C2_dom	UniProtKB/Swiss-Prot
	C2_domain_sf	UniProtKB/Swiss-Prot
	Synaptotagmin	UniProtKB/Swiss-Prot
KEGG Report	rno:60567	UniProtKB/Swiss-Prot
NCBI Gene	60567	ENTREZGENE
PANTHER	PTHR10024:SF46	UniProtKB/Swiss-Prot
	SYNAPTOTAGMIN	UniProtKB/Swiss-Prot
Pfam	PF00168	UniProtKB/Swiss-Prot
PhenoGen	Syt10	PhenoGen
PRINTS	C2DOMAIN	UniProtKB/Swiss-Prot
	SYNAPTOTAGMN	UniProtKB/Swiss-Prot
PROSITE	PS50004	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014296	RatGTEx
SMART	SM00239	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49562	UniProtKB/Swiss-Prot
UniProt	A0A8L2QAR7_RAT	UniProtKB/TrEMBL
	A6K7P3	ENTREZGENE, UniProtKB/TrEMBL
	O08625	ENTREZGENE
	Q1W5B9	ENTREZGENE, UniProtKB/TrEMBL
	Q925B8	ENTREZGENE
	SYT10_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q925B8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Syt10	synaptotagmin 10	Syt10	synaptotagmin X	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Syt10	synaptotagmin X		synaptotagmin 10	Name updated	1299863	APPROVED
2002-06-10	Syt10	synaptotagmin 10			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression induces in degenerating hippocampus and piriform cortex following kainic acid-induced seizure activity	61761

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message