Advanced Search (OLGA)

Gene: Tecr (trans-2,3-enoyl-CoA reductase) Rattus norvegicus

Analyze

Symbol:

Tecr (Ensembl: Tecrl2)

Name:

trans-2,3-enoyl-CoA reductase (Ensembl:trans-2,3-enoyl-CoA reductase like 2)

RGD ID:

620376

Description:

Predicted to enable very-long-chain enoyl-CoA reductase activity. Predicted to be involved in fatty acid elongation; sphingolipid metabolic process; and very long-chain fatty acid biosynthetic process. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in endoplasmic reticulum. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder 14. Orthologous to human TECR (trans-2,3-enoyl-CoA reductase); PARTICIPATES IN unsaturated fatty acid biosynthetic pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glycoprotein, synaptic 2; Gpsn2; neuroprotective protein 13; SC2; synaptic glycoprotein SC2; TER; very-long-chain enoyl-CoA reductase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TECR (trans-2,3-enoyl-CoA reductase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tecr (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tecr (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TECR (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TECR (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tecr (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TECR (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TECR (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tecr (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tecr (trans-2,3-enoyl-CoA reductase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PHF11 (PHD finger protein 11)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TECR (trans-2,3-enoyl-CoA reductase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tecr (trans-2,3-enoyl-CoA reductase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tecrb (trans-2,3-enoyl-CoA reductase b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tecra (trans-2,3-enoyl-CoA reductase a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	art-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TSC13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tecr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tecr	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	41,431,422 - 41,472,880 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	41,446,071 - 41,474,432 (+)	Ensembl				GRCr8
mRatBN7.2	19	24,526,700 - 24,568,168 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	24,541,615 - 24,568,168 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	31,348,025 - 31,389,488 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	32,002,436 - 32,043,900 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	34,225,211 - 34,266,534 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	24,705,478 - 24,732,024 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	24,705,481 - 24,732,024 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	35,684,508 - 35,711,344 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	26,232,602 - 26,259,289 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	24,083,400 - 24,108,790 (+)	NCBI		Celera
RGSC_v3.1	19	26,237,427 - 26,264,112 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive intellectual developmental disorder 14 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-bromohexadecanoic acid (ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

apigenin (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

azoxystrobin (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (EXP,ISO)

ciguatoxin CTX1B (ISO)

cobalt dichloride (ISO)

coumestrol (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

doxorubicin (ISO)

elemental selenium (ISO)

Enterolactone (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

gentamycin (EXP)

glyphosate (EXP)

GW 4064 (ISO)

hydrogen cyanide (ISO)

imidacloprid (EXP)

isotretinoin (ISO)

ivermectin (ISO)

maneb (ISO)

Mesaconitine (EXP)

methidathion (ISO)

nimesulide (EXP)

nitrates (ISO)

obeticholic acid (ISO)

oleic acid (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (ISO)

potassium cyanide (ISO)

resveratrol (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

Theaflavin 3,3'-digallate (ISO)

thiabendazole (EXP)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tremolite asbestos (ISO)

trichloroethene (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fatty acid biosynthetic process (IEA)

fatty acid elongation (IEA,ISO,ISS)

fatty acid metabolic process (IEA)

lipid metabolic process (IEA)

sphingolipid metabolic process (IBA,IEA,ISO,ISS)

steroid biosynthetic process (IEA)

very long-chain fatty acid biosynthetic process (IBA,IEA,ISO,ISS)

Cellular Component

endoplasmic reticulum (IBA,IEA,ISO,ISS)

endoplasmic reticulum membrane (IEA,ISO,ISS)

membrane (IEA)

Molecular Function

oxidoreductase activity (IEA)

oxidoreductase activity, acting on the CH-CH group of donors (IEA)

protein binding (ISO)

very-long-chain enoyl-CoA reductase activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

unsaturated fatty acid biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Molecular cloning of a novel mRNA using an antibody directed against synaptic glycoproteins.	Johnston IG, etal., J Neurosci Res 1992 Jun;32(2):159-66.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12482854	PMID:15489334	PMID:21124846	PMID:21630459	PMID:22871113	PMID:24220030	PMID:25049234	PMID:33450132

Genomics

Comparative Map Data

Tecr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	41,431,422 - 41,472,880 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	41,446,071 - 41,474,432 (+)	Ensembl				GRCr8
mRatBN7.2	19	24,526,700 - 24,568,168 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	24,541,615 - 24,568,168 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	31,348,025 - 31,389,488 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	32,002,436 - 32,043,900 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	34,225,211 - 34,266,534 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	24,705,478 - 24,732,024 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	24,705,481 - 24,732,024 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	35,684,508 - 35,711,344 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	26,232,602 - 26,259,289 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	24,083,400 - 24,108,790 (+)	NCBI		Celera
RGSC_v3.1	19	26,237,427 - 26,264,112 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

TECR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	14,527,726 - 14,565,980 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	14,517,085 - 14,565,988 (+)	Ensembl			hg38	GRCh38
GRCh37	19	14,640,372 - 14,676,792 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	14,501,382 - 14,537,792 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	14,501,381 - 14,537,791	NCBI
Celera	4	85,160,139 - 85,188,395 (-)	NCBI		Celera
Cytogenetic Map	19	p13.12	NCBI
HuRef	19	14,210,172 - 14,246,278 (+)	NCBI		HuRef
CHM1_1	19	14,640,339 - 14,677,621 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	14,654,487 - 14,692,721 (+)	NCBI		T2T-CHM13v2.0

Tecr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	84,298,327 - 84,321,120 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	84,298,327 - 84,334,600 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	83,571,698 - 83,594,491 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	83,571,698 - 83,607,971 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	86,095,597 - 86,118,390 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	86,461,805 - 86,484,570 (-)	NCBI		MGSCv36	mm8
Celera	8	87,857,633 - 87,880,363 (-)	NCBI		Celera
Cytogenetic Map	8	C2	NCBI
cM Map	8	40.22	NCBI

Tecr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	33,135,646 - 33,143,145 (+)	Ensembl
ChiLan1.0	NW_004955415	33,112,098 - 33,138,810 (+)	NCBI	ChiLan1.0	ChiLan1.0

TECR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	19,459,266 - 19,495,433 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	18,461,551 - 18,497,649 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	14,092,967 - 14,129,025 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	14,936,911 - 14,972,784 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	14,936,911 - 14,972,784 (+)	Ensembl			panPan2	panpan1.1

TECR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	48,094,891 - 48,120,384 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	48,094,961 - 48,120,291 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	47,971,579 - 47,996,850 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	48,612,057 - 48,637,301 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	48,612,060 - 48,637,270 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	47,826,045 - 47,851,234 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	48,252,269 - 48,277,610 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	48,495,253 - 48,520,440 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tecr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	207,273,757 - 207,303,057 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	3,051,566 - 3,084,788 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	3,051,657 - 3,080,948 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TECR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	64,723,698 - 64,752,209 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	65,189,388 - 65,191,199 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TECR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	13,186,972 - 13,224,908 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	13,188,450 - 13,227,776 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666074	6,430,084 - 6,467,976 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tecr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	1,643,520 - 1,668,550 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624901	1,643,465 - 1,668,544 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tecr
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	16,673,853 - 16,700,606 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tecr
294 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	47
Count of miRNA genes:	44
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000037608
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	40727092	54856850	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	40727092	54856850	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	40727092	54856850	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat

Markers in Region

RH139870

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	24,566,788 - 24,567,167 (-)	MAPPER	mRatBN7.2
mRatBN7.2	1	47,264,139 - 47,264,343 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,587,515 - 47,587,718	NCBI	Rnor6.0
Rnor_6.0	19	24,706,479 - 24,706,854	NCBI	Rnor6.0
Rnor_5.0	19	35,685,509 - 35,686,173	UniSTS	Rnor5.0
Rnor_5.0	1	48,887,902 - 48,888,105	UniSTS	Rnor5.0
RGSC_v3.4	1	41,483,433 - 41,483,636	UniSTS	RGSC3.4
RGSC_v3.4	19	26,257,866 - 26,258,288	UniSTS	RGSC3.4
Celera	1	42,948,096 - 42,948,299	UniSTS
RH 3.4 Map	1	541.7	UniSTS
Cytogenetic Map	1	q11	UniSTS
Cytogenetic Map	19	q11	UniSTS

BI282960

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	24,567,146 - 24,567,622 (-)	MAPPER	mRatBN7.2
mRatBN7.2	1	47,263,950 - 47,264,160 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,587,326 - 47,587,535	NCBI	Rnor6.0
Rnor_6.0	19	24,706,024 - 24,706,499	NCBI	Rnor6.0
Rnor_5.0	19	35,685,054 - 35,685,529	UniSTS	Rnor5.0
Rnor_5.0	1	48,887,713 - 48,887,922	UniSTS	Rnor5.0
RGSC_v3.4	19	26,258,268 - 26,258,743	UniSTS	RGSC3.4
RGSC_v3.4	1	41,483,244 - 41,483,453	UniSTS	RGSC3.4
Celera	1	42,947,907 - 42,948,116	UniSTS
Celera	19	24,107,769 - 24,108,244	UniSTS
RH 3.4 Map	1	540.4	UniSTS
Cytogenetic Map	19	q11	UniSTS
Cytogenetic Map	1	q11	UniSTS

AI173355

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	41,472,143 - 41,472,343 (+)	Marker Load Pipeline
mRatBN7.2	19	24,567,431 - 24,567,631 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	24,706,015 - 24,706,214	NCBI	Rnor6.0
Rnor_5.0	19	35,685,045 - 35,685,244	UniSTS	Rnor5.0
RGSC_v3.4	19	26,258,553 - 26,258,752	UniSTS	RGSC3.4
Celera	19	24,108,054 - 24,108,253	UniSTS
Cytogenetic Map	19	q11	UniSTS

Gpsn2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	47,263,787 - 47,263,993 (+)	MAPPER	mRatBN7.2
mRatBN7.2	19	24,567,579 - 24,568,023 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	24,705,623 - 24,706,066	NCBI	Rnor6.0
Rnor_6.0	1	47,587,163 - 47,587,368	NCBI	Rnor6.0
Rnor_5.0	19	35,684,653 - 35,685,096	UniSTS	Rnor5.0
Rnor_5.0	1	48,887,550 - 48,887,755	UniSTS	Rnor5.0
RGSC_v3.4	19	26,258,701 - 26,259,144	UniSTS	RGSC3.4
RGSC_v3.4	1	41,483,081 - 41,483,286	UniSTS	RGSC3.4
Celera	1	42,947,744 - 42,947,949	UniSTS
Celera	19	24,108,202 - 24,108,645	UniSTS
Cytogenetic Map	1	q11	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001398679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_138549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC102976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU000473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S45663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037608 ⟹ ENSRNOP00000035416

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,541,615 - 24,568,165 (+)	Ensembl
Rnor_6.0 Ensembl	19	24,705,481 - 24,732,024 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096596 ⟹ ENSRNOP00000080279

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,564,386 - 24,568,168 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098878 ⟹ ENSRNOP00000093730

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,565,140 - 24,568,165 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102273 ⟹ ENSRNOP00000095860

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,541,615 - 24,568,160 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103758 ⟹ ENSRNOP00000097089

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,541,651 - 24,568,124 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104728 ⟹ ENSRNOP00000097514

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,541,685 - 24,568,142 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115783 ⟹ ENSRNOP00000083676

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,541,685 - 24,568,163 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115881 ⟹ ENSRNOP00000089376

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,541,642 - 24,568,168 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120184 ⟹ ENSRNOP00000094888

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	24,565,135 - 24,568,165 (+)	Ensembl

RefSeq Acc Id:

NM_001398679 ⟹ NP_001385608

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,446,356 - 41,472,880 (+)	NCBI
mRatBN7.2	19	24,541,638 - 24,568,168 (+)	NCBI

RefSeq Acc Id:

NM_001398680 ⟹ NP_001385609

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,469,902 - 41,472,880 (+)	NCBI
mRatBN7.2	19	24,565,187 - 24,568,168 (+)	NCBI

RefSeq Acc Id:

NM_001398681 ⟹ NP_001385610

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,469,902 - 41,472,880 (+)	NCBI
mRatBN7.2	19	24,565,187 - 24,568,168 (+)	NCBI

RefSeq Acc Id:

NM_001398682 ⟹ NP_001385611

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,431,422 - 41,472,880 (+)	NCBI
mRatBN7.2	19	24,526,700 - 24,568,168 (+)	NCBI

RefSeq Acc Id:

NM_138549 ⟹ NP_612558

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,446,356 - 41,472,880 (+)	NCBI
mRatBN7.2	19	24,541,638 - 24,568,168 (+)	NCBI
Rnor_6.0	19	24,705,478 - 24,732,024 (-)	NCBI
Rnor_5.0	19	35,684,508 - 35,711,344 (-)	NCBI
RGSC_v3.4	19	26,232,602 - 26,259,289 (+)	RGD
Celera	19	24,083,400 - 24,108,790 (+)	RGD

Sequence:

show sequence

AGAAGGGACGCACGCATAGAGAGGGGCGGAGCCGGAGCCCTGGAGTGCTGCTCCTTGTGTGTGT
GGGGCTGGGTGGTGGTTGGTGCGGCAGGGCGGCTACTCAGCTGCAGCAGTGCAGGTGCCATCCT
GTGGAAGAACCATGAAGCACTACGAGGTGGAGATTCGGGATGCAAAGACGAGGGAGAAGCTGTG
CTTCCTGGACAAGGTAGAGCCTCAGGCCACCATTTCTGAAATCAAGACCCTTTTCACCAAGACA
CACCCGCAGTGGTATCCTGCCCGCCAGTCCCTCCGCCTGGACCCCAAGGGGAAGTCCCTGAAAG
ATGAAGATGTGTTGCAGAAGCTTCCTGTGGGCACCACAGCTACGCTCTACTTCCGGGACCTCGG
GGCCCAGATCAGCTGGGTGACGGTCTTCCTGACGGAGTATGCTGGGCCCCTTTTCATCTACCTG
CTCTTCTACTTCCGGGTGCCCTTCATTTATGGCCGCAAATACGACTTTACATCCAGTCGGCATA
CTGTGGTGCACCTCGCCTGCATGTGCCACTCCTTCCACTACATCAAGCGCCTGCTGGAGACTCT
CTTCGTGCACCGATTCTCTCACGGAACCATGCCCCTGCGAAACATCTTCAAAAACTGCACCTAC
TACTGGGGCTTTGCTGCGTGGATGGCTTATTACATCAACCACCCTCTCTACACACCCCCTACCT
ATGGAGTTCAGCAGGTTAAGCTGGCACTGGCCATTTTTGTGATCTGTCAGCTTGGGAACTTCTC
TATCCACATGGCTCTCCGGGATCTTCGACCAGCGGGGTCGAAAACCAGGAAGATCCCATACCCC
ACCAAGAACCCCTTCACCTGGCTGTTTCTGTTGGTGTCCTGTCCCAACTACACTTACGAGGTCG
GCTCCTGGATTGGCTTTGCCATTATGACACAGTGTGTCCCAGTGGCCCTCTTCTCCCTGGTGGG
CTTCACCCAGATGACTATCTGGGCCAAGGGCAAGCATCGCAGCTACCTGAAGGAGTTCCGTGAC
TACCCACCCCTGCGCATGCCCATAATCCCCTTCCTGCTCTGAGCAGCTCCTCCCGAGCTCAGCC
CAGTAATGCCCTCCACCTACTACCCCTGTCCTGATGTGGCTGGCCAAGGCTCTCCAGCAGCAAC
AATAAAACCTGCTTACCCAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063277767 ⟹ XP_063133837

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,469,801 - 41,472,880 (+)	NCBI

RefSeq Acc Id:

XM_063277768 ⟹ XP_063133838

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,469,801 - 41,472,880 (+)	NCBI

RefSeq Acc Id:

XM_063277769 ⟹ XP_063133839

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,446,308 - 41,472,880 (+)	NCBI

RefSeq Acc Id:

XM_063277770 ⟹ XP_063133840

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,446,296 - 41,472,880 (+)	NCBI

RefSeq Acc Id:

XM_063277771 ⟹ XP_063133841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,431,569 - 41,472,880 (+)	NCBI

RefSeq Acc Id:

XM_063277772 ⟹ XP_063133842

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	41,431,567 - 41,472,880 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001385608	(Get FASTA)	NCBI Sequence Viewer
	NP_001385609	(Get FASTA)	NCBI Sequence Viewer
	NP_001385610	(Get FASTA)	NCBI Sequence Viewer
	NP_001385611	(Get FASTA)	NCBI Sequence Viewer
	NP_612558	(Get FASTA)	NCBI Sequence Viewer
	XP_063133837	(Get FASTA)	NCBI Sequence Viewer
	XP_063133838	(Get FASTA)	NCBI Sequence Viewer
	XP_063133839	(Get FASTA)	NCBI Sequence Viewer
	XP_063133840	(Get FASTA)	NCBI Sequence Viewer
	XP_063133841	(Get FASTA)	NCBI Sequence Viewer
	XP_063133842	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB23534	(Get FASTA)	NCBI Sequence Viewer
	AAH59115	(Get FASTA)	NCBI Sequence Viewer
	ABY47888	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035416.4
	ENSRNOP00000080279
	ENSRNOP00000083676
GenBank Protein	Q64232	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_612558 ⟸ NM_138549
- Peptide Label:	isoform 1
- UniProtKB:	Q64232 (UniProtKB/Swiss-Prot), B3SVE9 (UniProtKB/TrEMBL), A0A8I6AKU7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKHYEVEIRDAKTREKLCFLDKVEPQATISEIKTLFTKTHPQWYPARQSLRLDPKGKSLKDEDV LQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFTSSRHTVVH LACMCHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYINHPLYTPPTYGVQ QVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWI GFAIMTQCVPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLRMPIIPFLL hide sequence

Ensembl Acc Id:

ENSRNOP00000035416 ⟸ ENSRNOT00000037608

Ensembl Acc Id:

ENSRNOP00000083676 ⟸ ENSRNOT00000115783

Ensembl Acc Id:

ENSRNOP00000093730 ⟸ ENSRNOT00000098878

Ensembl Acc Id:

ENSRNOP00000095860 ⟸ ENSRNOT00000102273

Ensembl Acc Id:

ENSRNOP00000097514 ⟸ ENSRNOT00000104728

Ensembl Acc Id:

ENSRNOP00000097089 ⟸ ENSRNOT00000103758

Ensembl Acc Id:

ENSRNOP00000080279 ⟸ ENSRNOT00000096596

Ensembl Acc Id:

ENSRNOP00000094888 ⟸ ENSRNOT00000120184

Ensembl Acc Id:

ENSRNOP00000089376 ⟸ ENSRNOT00000115881

RefSeq Acc Id:	NP_001385611 ⟸ NM_001398682
- Peptide Label:	isoform 5
- UniProtKB:	A6IYE1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001385608 ⟸ NM_001398679
- Peptide Label:	isoform 2
- UniProtKB:	A0A8I6AKU7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001385610 ⟸ NM_001398681
- Peptide Label:	isoform 4
- UniProtKB:	A0A8I6ALN4 (UniProtKB/TrEMBL), A0A8I6AKU7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001385609 ⟸ NM_001398680
- Peptide Label:	isoform 3
- UniProtKB:	A0A8I6AI38 (UniProtKB/TrEMBL), A0A8I6AKU7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133842 ⟸ XM_063277772
- Peptide Label:	isoform X5
- UniProtKB:	A6IYE1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133841 ⟸ XM_063277771
- Peptide Label:	isoform X5
- UniProtKB:	A6IYE1 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133840 ⟸ XM_063277770
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AKU7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133839 ⟸ XM_063277769
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AKU7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133837 ⟸ XM_063277767
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AKU7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133838 ⟸ XM_063277768
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AKU7 (UniProtKB/TrEMBL)

Protein Domains

3-oxo-5-alpha-steroid 4-dehydrogenase C-terminal TECR-like N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64232-F1-model_v2	AlphaFold	Q64232	1-308	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701001

Promoter ID:

EPDNEW_R11524

Type:

initiation region

Name:

Tecr_1

Description:

trans-2,3-enoyl-CoA reductase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	24,731,981 - 24,732,041	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620376	AgrOrtholog
BioCyc Gene	G2FUF-6016	BioCyc
BioCyc Pathway	PWY-5080 [very long chain fatty acid biosynthesis I]	BioCyc
	PWY-6598 [sciadonate biosynthesis]	BioCyc
	PWY-7036 [very long chain fatty acid biosynthesis II]	BioCyc
	PWY-7049 [icosapentaenoate biosynthesis II (6-desaturase, mammals)]	BioCyc
	PWY-7592 [arachidonate biosynthesis III (6-desaturase, mammals)]	BioCyc
	PWY-7606 [docosahexaenoate biosynthesis III (6-desaturase, mammals)]	BioCyc
	PWY-7619 [juniperonate biosynthesis]	BioCyc
	PWY-7726 [(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase)]	BioCyc
	PWY-8041 [ultra-long-chain fatty acid biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-5080	BioCyc
	PWY-6598	BioCyc
	PWY-7036	BioCyc
	PWY-7049	BioCyc
	PWY-7592	BioCyc
	PWY-7606	BioCyc
	PWY-7619	BioCyc
	PWY-7726	BioCyc
	PWY-8041	BioCyc
Ensembl Genes	ENSRNOG00000021808	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000037608.5	UniProtKB/Swiss-Prot
	ENSRNOT00000096596	ENTREZGENE
	ENSRNOT00000115783	ENTREZGENE
Gene3D-CATH	1.20.120.1630	UniProtKB/Swiss-Prot
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6920522	IMAGE-MGC_LOAD
InterPro	3-oxo-5_a-steroid_4-DH_C	UniProtKB/Swiss-Prot
	SRD5A/TECR	UniProtKB/Swiss-Prot
	TECR-like_N	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
KEGG Report	rno:191576	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72691	IMAGE-MGC_LOAD
NCBI Gene	191576	ENTREZGENE
PANTHER	PTHR10556	UniProtKB/Swiss-Prot
	VERY-LONG-CHAIN ENOYL-COA REDUCTASE	UniProtKB/Swiss-Prot
Pfam	Steroid_dh	UniProtKB/Swiss-Prot
	TECR_N	UniProtKB/Swiss-Prot
PhenoGen	Tecr	PhenoGen
PROSITE	S5A_REDUCTASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021808	RatGTEx
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZWG2_RAT	UniProtKB/TrEMBL
	A0A8I6AI38	ENTREZGENE
	A0A8I6AKU7	ENTREZGENE
	A0A8I6ALN4	ENTREZGENE
	A0A8I6AMG3_RAT	UniProtKB/TrEMBL
	A0A8I6G6D7_RAT	UniProtKB/TrEMBL
	A6IYE1	ENTREZGENE, UniProtKB/TrEMBL
	B3SVE9	ENTREZGENE, UniProtKB/TrEMBL
	Q64232	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-10-22	Tecr	trans-2,3-enoyl-CoA reductase	Gpsn2	glycoprotein, synaptic 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Gpsn2	glycoprotein, synaptic 2	SC2	synaptic glycoprotein SC2	Symbol and Name updated	1299863	APPROVED
2002-08-07	SC2	synaptic glycoprotein SC2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	shows some similarity to 5 alpha-reductase, a microsomal membrane protein important in testosterone metabolism	634003

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways