Advanced Search (OLGA)

Gene: Nme7 (NME/NM23 family member 7) Rattus norvegicus

Analyze

Symbol:

Nme7

Name:

NME/NM23 family member 7

RGD ID:

619880

Description:

Predicted to enable 3'-5'-DNA exonuclease activity and protein kinase activity. Predicted to be involved in several processes, including DNA catabolic process; flagellated sperm motility; and regulation of microtubule nucleation. Predicted to act upstream of or within several processes, including cellular response to leukemia inhibitory factor; epithelial cilium movement involved in extracellular fluid movement; and intraciliary transport. Predicted to be located in ciliary basal body; cytoplasm; and nucleus. Predicted to be part of gamma-tubulin ring complex. Predicted to be active in axonemal A tubule inner sheath; centrosome; and sperm flagellum. Orthologous to human NME7 (NME/NM23 family member 7); PARTICIPATES IN purine metabolic pathway; pyrimidine metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

3'-5' exonuclease NME7; NDK 7; NDP kinase 7; NDP kinase homolog 7; nm23-H7; Nm23-r7; non-metastatic cells 7, protein expressed in; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 7; nucleoside diphosphate kinase homolog 7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NME7 (NME/NM23 family member 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Nme7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nme7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NME7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NME7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nme7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NME7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NME7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nme7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nme7 (NME/NM23 family member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RNPEP (arginyl aminopeptidase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NME7 (NME/NM23 family member 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nme7 (NME/NM23 family member 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nme7 (NME/NM23 family member 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	nmdyn-D7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nme7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nme7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	79,190,462 - 79,319,890 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	79,190,334 - 79,319,890 (+)	Ensembl				GRCr8
mRatBN7.2	13	76,657,303 - 76,786,768 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	76,657,367 - 76,786,765 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	79,275,861 - 79,405,137 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	80,579,866 - 80,709,135 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	77,834,641 - 77,964,182 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	82,607,844 - 82,737,383 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	82,626,685 - 82,737,343 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	87,491,657 - 87,621,629 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	80,073,815 - 80,214,238 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	76,390,643 - 76,518,136 (+)	NCBI		Celera
RGSC_v3.1	13	80,088,002 - 80,228,426 (+)	NCBI
Cytogenetic Map	13	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

gastrointestinal stromal tumor (ISO)

hydrocephalus (ISS)

substance-related disorder (ISO)

visceral heterotaxy 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (EXP,ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

Bufotalin (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

doxifluridine (ISO)

endosulfan (EXP)

flavonoids (EXP)

formaldehyde (ISO)

genistein (EXP)

gentamycin (EXP)

leflunomide (EXP)

methimazole (EXP)

Nonylphenol (EXP)

oxaliplatin (EXP)

ozone (ISO)

p-toluidine (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

piroxicam (ISO)

potassium chromate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

troglitazone (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brain development (ISO)

cellular response to leukemia inhibitory factor (ISO)

cilium assembly (IEA,ISO,ISS)

CTP biosynthetic process (IEA)

determination of left/right symmetry (ISO)

DNA catabolic process (IEA,ISO,ISS)

epithelial cilium movement involved in extracellular fluid movement (ISO)

flagellated sperm motility (IEA,ISO,ISS)

GTP biosynthetic process (IEA)

intraciliary transport (ISO)

left/right pattern formation (ISO)

receptor clustering (ISO)

regulation of microtubule nucleation (IEA,ISO)

UTP biosynthetic process (IEA)

Cellular Component

axonemal A tubule inner sheath (IEA,ISO,ISS)

axonemal microtubule (IBA,IEA,ISO,ISS)

axoneme (IEA)

centrosome (IBA,IEA,ISO,ISS)

ciliary basal body (IEA,ISO,ISS)

cilium (IEA,ISO,ISS)

cytoplasm (IEA,ISO,ISS)

cytosol (IEA,ISO)

extracellular region (IEA)

gamma-tubulin ring complex (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO,ISS)

plasma membrane (IEA)

sperm flagellum (IEA,ISO,ISS)

spindle (IEA)

Molecular Function

3'-5' exonuclease activity (IEA)

3'-5'-DNA exonuclease activity (IEA,ISO,ISS)

ATP binding (IEA)

hydrolase activity (IEA)

kinase activity (IEA)

nucleoside diphosphate kinase activity (IEA,ISO)

nucleotide binding (IEA)

protein kinase activity (IEA,ISO)

protein serine kinase activity (IEA)

protein serine/threonine kinase activity (IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	Situs inversus in Dpcd/Poll-/-, Nme7-/- , and Pkd1l1-/- mice.	Vogel P, etal., Vet Pathol. 2010 Jan;47(1):120-31. doi: 10.1177/0300985809353553.

Additional References at PubMed

PMID:20439489	PMID:21289087	PMID:21399614	PMID:21746835	PMID:30484681	PMID:33916973	PMID:34356103

Genomics

Comparative Map Data

Nme7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	79,190,462 - 79,319,890 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	79,190,334 - 79,319,890 (+)	Ensembl				GRCr8
mRatBN7.2	13	76,657,303 - 76,786,768 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	76,657,367 - 76,786,765 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	79,275,861 - 79,405,137 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	80,579,866 - 80,709,135 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	77,834,641 - 77,964,182 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	82,607,844 - 82,737,383 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	82,626,685 - 82,737,343 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	87,491,657 - 87,621,629 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	80,073,815 - 80,214,238 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	76,390,643 - 76,518,136 (+)	NCBI		Celera
RGSC_v3.1	13	80,088,002 - 80,228,426 (+)	NCBI
Cytogenetic Map	13	q23	NCBI

NME7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	169,132,531 - 169,367,797 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	169,132,531 - 169,367,948 (-)	Ensembl			hg38	GRCh38
GRCh37	1	169,101,769 - 169,337,035 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	167,368,393 - 167,603,810 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	165,833,432 - 166,068,844	NCBI
Celera	1	142,211,825 - 142,446,965 (-)	NCBI		Celera
Cytogenetic Map	1	q24.2	NCBI
HuRef	1	140,347,887 - 140,560,303 (-)	NCBI		HuRef
CHM1_1	1	170,523,830 - 170,759,217 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	168,488,013 - 168,723,109 (-)	NCBI		T2T-CHM13v2.0

Nme7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	164,135,091 - 164,264,870 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	164,131,690 - 164,265,294 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	164,307,524 - 164,437,300 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	164,304,121 - 164,437,725 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	166,237,806 - 166,367,428 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	166,144,400 - 166,273,969 (+)	NCBI		MGSCv36	mm8
Celera	1	166,745,201 - 166,878,654 (+)	NCBI		Celera
Cytogenetic Map	1	H2.2	NCBI
cM Map	1	71.63	NCBI

Nme7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	7,880,157 - 8,073,186 (+)	Ensembl
ChiLan1.0	NW_004955462	7,879,754 - 8,073,207 (+)	NCBI	ChiLan1.0	ChiLan1.0

NME7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	80,401,410 - 80,631,095 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	80,069,809 - 80,299,561 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	144,620,719 - 144,850,230 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	148,343,020 - 148,572,499 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	148,343,026 - 148,572,499 (-)	Ensembl			panPan2	panpan1.1

NME7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	29,201,273 - 29,464,072 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	29,206,307 - 29,463,467 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	28,733,034 - 28,995,246 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	29,003,245 - 29,265,627 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	29,008,284 - 29,265,621 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	28,851,492 - 29,113,370 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	28,887,185 - 29,155,186 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	29,123,851 - 29,386,154 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nme7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	99,433,937 - 99,591,586 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	17,280,464 - 17,438,084 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	17,280,661 - 17,438,496 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NME7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	81,639,909 - 81,911,743 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	81,639,907 - 81,912,276 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	89,260,793 - 89,530,302 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NME7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	59,685,437 - 59,899,458 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	59,685,531 - 59,898,677 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	61,360,767 - 61,576,001 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nme7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624826	7,078,140 - 7,258,997 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624826	7,077,885 - 7,300,398 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nme7
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	43,532,416 - 43,662,125 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nme7
815 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	33
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000058897
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

D13Mco7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	76,688,149 - 76,688,352 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	82,638,743 - 82,638,945	NCBI	Rnor6.0
Rnor_5.0	13	87,523,029 - 87,523,231	UniSTS	Rnor5.0
RGSC_v3.4	13	80,115,672 - 80,115,875	RGD	RGSC3.4
RGSC_v3.4	13	80,115,673 - 80,115,875	UniSTS	RGSC3.4
Celera	13	76,419,652 - 76,419,854	UniSTS
RGSC_v3.1	13	80,129,860 - 80,130,063	RGD
Cytogenetic Map	13	q22-q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598659	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF202049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000058897 ⟹ ENSRNOP00000055684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	79,190,547 - 79,319,890 (+)	Ensembl
mRatBN7.2 Ensembl	13	76,657,367 - 76,786,765 (+)	Ensembl
Rnor_6.0 Ensembl	13	82,626,685 - 82,737,343 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117443 ⟹ ENSRNOP00000077126

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	79,190,334 - 79,319,890 (+)	Ensembl
mRatBN7.2 Ensembl	13	76,657,421 - 76,786,765 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000128304 ⟹ ENSRNOP00000110998

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	79,190,334 - 79,319,645 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000147260 ⟹ ENSRNOP00000103556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	79,190,334 - 79,283,636 (+)	Ensembl

RefSeq Acc Id:

NM_138532 ⟹ NP_612541

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	79,190,581 - 79,319,890 (+)	NCBI
mRatBN7.2	13	76,657,442 - 76,786,762 (+)	NCBI
Rnor_6.0	13	82,607,844 - 82,737,343 (+)	NCBI
Rnor_5.0	13	87,491,657 - 87,621,629 (+)	NCBI
RGSC_v3.4	13	80,073,815 - 80,214,238 (+)	RGD
Celera	13	76,390,643 - 76,518,136 (+)	RGD

Sequence:

show sequence

GCTGAGATCCACAAACTATGTTTTCAAGCTTGCAGGCCCATTTCGACGTGATGCTGTATCATCA
CTAACCTGAATATTGGAGTGTGTTCTCCCAGGCGGCGGAGTTCTGCCTAGCATCTCCTACCAGG
ACCGCTTAGTAATAGATGTCTGCAGGCTCAGCTTCTAGTCCATTGCATACTTTCCAGATCTCTG
TGTTTTAGCAGCCGGCATTGCATCCTCGGGCAGCATGAAAGCTGGTCAGCAGGGAAGAAGTTGC
GGTTTGATTTCTCCGTATCTTGCACCCAAGAATCAGAGTGAGAGGTTTGCTTTCATTGCAGAGT
GGTATGACCCAAATGCTTCACTGCTCCGACGCTATGAGCTTCTGTACTACCCGGTAGATGGATC
TGTTGAAATGCATGATGTCAAGAATCGTCGCACCTTCTTAAAGCGGACCAAGTATGAGGACCTG
CGCGTGGAAGATTTATTTATAGGCAACAAAGTCAATGTGTTTTCTCGACAGCTGGTGCTGATTG
ACTATGGGGACCAGTACACAGCCCGCCAGCTGGGCAGCAGGAAAGAGAAAACTTTAGCCCTCAT
CAAACCGGATGCAGTATCGAAGGCTGGAGAAATCATTGAGATGATAAACAAAAGTGGGTTCACT
ATAACCAAACTCCGAATGATGACGCTGTCAAGGAAAGAAGCAGCAGACTTTCATGTAGACCACC
ACTCAAGGCCTTTTTATAACGAACTGATCCAGTTTATCACAAGTGGGCCTGTTATTGCCATGGA
GATCTTGAGAGATGATGCCATATGTGAGTGGAAAAGGTTGCTTGGACCCGCAAACTCTGGGATA
GCGCGTTCAGAAGCCCCCGGAAGCGTCCGAGCCCTCTTTGGGACAGATGGCATAAGAAATGCGG
CTCACGGCTCTGATACTTTTGAGTCCGCTGCCAGAGAAATGGAATTATTTTTCCCCTCCAGTGG
AGGCTGTGGCCCAACAAACACTGCTAAATTTACCAATTGTACCTGCTGCATTATCAAGCCCCAT
GCTATCAGTGAAGGAATGTTGGGAAAGATTTTAATAGCTATTCGAGATGCATGCTTTGAGATCT
CAGCAATACAGATGTTCAATATGGATCGAGCTAATGTTGAAGAATTCTATGAAGTCTATAAAGG
TGTACTGTCCGATTATAATGACATGGTGACAGAGCTGTACTCCGGCCCTTGCGTAGCAATAGAG
ATCCAGCAGAGCAATCCTACGAAGACGTTCCGAGAATTCTGTGGACCTTCCGATCCTGAAATCG
CCAGGCATTTACGACCTGAGACCCTCAGGGCAAATTTTGGTAAAACCAAGGTTCAAAATGCTGT
TCATTGTACAGATCTGCCAGAGGATGGGCTCCTGGAGGTCCAGTATTTCTTCAAGATCTTGGAT
AATTAGCCGTACAGAGTAAAGACAACACAGACGGAGACGCTCAGACAAGTGAGTCACACACGTG
AAGAATGTGTTCATTCTTTTATTGTCCATTGTGTTAACCTGACTGACACAAGACCAACAAGAGC
ACTGTACTCCTGGCAATCATTACATATGCTAGAACATGGATTTGCACTGTAGACAACATTTAAC
ACCAGTCTATGGGGTACTGCATTGCTTTTTATAAAGTTCAAAATAAAGATTTTATTTTC

hide sequence

RefSeq Acc Id:

XM_063272010 ⟹ XP_063128080

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	79,190,462 - 79,235,606 (+)	NCBI

RefSeq Acc Id:

XM_063272011 ⟹ XP_063128081

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	79,190,462 - 79,241,251 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_612541	(Get FASTA)	NCBI Sequence Viewer
	XP_063128080	(Get FASTA)	NCBI Sequence Viewer
	XP_063128081	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF20907	(Get FASTA)	NCBI Sequence Viewer
	AAH60314	(Get FASTA)	NCBI Sequence Viewer
	EDM09355	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000077126
	ENSRNOP00055024111
	ENSRNOP00060012599
GenBank Protein	Q9QXL7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_612541 ⟸ NM_138532

- UniProtKB:

A6IDE2 (UniProtKB/Swiss-Prot), Q9QXL7 (UniProtKB/Swiss-Prot), Q6PAG9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKAGQQGRSCGLISPYLAPKNQSERFAFIAEWYDPNASLLRRYELLYYPVDGSVEMHDVKNRRT
FLKRTKYEDLRVEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEI
IEMINKSGFTITKLRMMTLSRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWK
RLLGPANSGIARSEAPGSVRALFGTDGIRNAAHGSDTFESAAREMELFFPSSGGCGPTNTAKFT
NCTCCIIKPHAISEGMLGKILIAIRDACFEISAIQMFNMDRANVEEFYEVYKGVLSDYNDMVTE
LYSGPCVAIEIQQSNPTKTFREFCGPSDPEIARHLRPETLRANFGKTKVQNAVHCTDLPEDGLL
EVQYFFKILDN

hide sequence

Ensembl Acc Id:

ENSRNOP00000055684 ⟸ ENSRNOT00000058897

Ensembl Acc Id:

ENSRNOP00000077126 ⟸ ENSRNOT00000117443

RefSeq Acc Id:	XP_063128081 ⟸ XM_063272011
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063128080 ⟸ XM_063272010
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000103556 ⟸ ENSRNOT00000147260

Ensembl Acc Id:

ENSRNOP00000110998 ⟸ ENSRNOT00000128304

Protein Domains

DM10

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QXL7-F1-model_v2	AlphaFold	Q9QXL7	1-395	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619880	AgrOrtholog
BioCyc Gene	G2FUF-17597	BioCyc
BioCyc Pathway	PWY-7176 [UTP and CTP de novo biosynthesis]	BioCyc
	PWY-7184 [pyrimidine deoxyribonucleotides de novo biosynthesis I]	BioCyc
	PWY-7197 [pyrimidine deoxyribonucleotide phosphorylation]	BioCyc
	PWY-7205 [CMP phosphorylation]	BioCyc
	PWY-7210 [pyrimidine deoxyribonucleotides biosynthesis from CTP]	BioCyc
	PWY-7221 [guanosine ribonucleotides de novo biosynthesis]	BioCyc
	PWY-7224 [purine deoxyribonucleosides salvage]	BioCyc
	PWY-7226 [guanosine deoxyribonucleotides de novo biosynthesis I]	BioCyc
	PWY-7227 [adenosine deoxyribonucleotides de novo biosynthesis I]	BioCyc
BioCyc Pathway Image	PWY-7176	BioCyc
	PWY-7184	BioCyc
	PWY-7197	BioCyc
	PWY-7205	BioCyc
	PWY-7210	BioCyc
	PWY-7221	BioCyc
	PWY-7224	BioCyc
	PWY-7226	BioCyc
	PWY-7227	BioCyc
Ensembl Genes	ENSRNOG00000002898	Ensembl, ENTREZGENE
	ENSRNOG00055017744	UniProtKB/Swiss-Prot
	ENSRNOG00060009526	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000117443	ENTREZGENE
	ENSRNOT00055030019	UniProtKB/Swiss-Prot
	ENSRNOT00060016105	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.29.170	UniProtKB/Swiss-Prot
	3.30.70.141	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918381	IMAGE-MGC_LOAD
InterPro	NDK-like_dom	UniProtKB/Swiss-Prot
	NDK-like_dom_sf	UniProtKB/Swiss-Prot
	NDPK7	UniProtKB/Swiss-Prot
	NDPk7A	UniProtKB/Swiss-Prot
	NDPk7B	UniProtKB/Swiss-Prot
	Nucleoside_diP_kinase	UniProtKB/Swiss-Prot
	Uncharacterised_DM10	UniProtKB/Swiss-Prot
KEGG Report	rno:171566	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72693	IMAGE-MGC_LOAD
NCBI Gene	171566	ENTREZGENE
PANTHER	NUCLEOSIDE DIPHOSPHATE KINASE 7	UniProtKB/Swiss-Prot
	NUCLEOSIDE DIPHOSPHATE KINASE 7	UniProtKB/Swiss-Prot
Pfam	NDK	UniProtKB/Swiss-Prot
	PH_NDK7_N	UniProtKB/Swiss-Prot
PhenoGen	Nme7	PhenoGen
PIRSF	NDK7	UniProtKB/Swiss-Prot
PRINTS	NUCDPKINASE	UniProtKB/Swiss-Prot
PROSITE	DM10	UniProtKB/Swiss-Prot
	NDPK_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002898	RatGTEx
	ENSRNOG00055017744	RatGTEx
	ENSRNOG00060009526	RatGTEx
SMART	DM10	UniProtKB/Swiss-Prot
	NDK	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54919	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y7G4_RAT	UniProtKB/TrEMBL
	A0ABK0L376_RAT	UniProtKB/TrEMBL
	A0ABK0M1N6_RAT	UniProtKB/TrEMBL
	A6IDE2	ENTREZGENE
	F1LNL9_RAT	UniProtKB/TrEMBL
	NDK7_RAT	UniProtKB/Swiss-Prot
	Q6PAG9	ENTREZGENE
	Q9QXL7	ENTREZGENE
UniProt Secondary	A6IDE2	UniProtKB/Swiss-Prot
	Q6PAG9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-05	Nme7	NME/NM23 family member 7	Nme7	non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-25	Nme7	non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)	Nme7	non-metastatic cells 7, protein expressed in	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Nme7	non-metastatic cells 7, protein expressed in		NME7	Name updated	1299863	APPROVED
2002-08-07	Nme7	NME7			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

BioCyc Pathways