Advanced Search (OLGA)

Gene: Psmb5 (proteasome 20S subunit beta 5) Rattus norvegicus

Analyze

Symbol:

Psmb5

Name:

proteasome 20S subunit beta 5

RGD ID:

61879

Description:

Predicted to enable endopeptidase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within proteolysis and response to oxidative stress. Predicted to be located in nucleoplasm. Predicted to be part of proteasome core complex, beta-subunit complex. Predicted to be active in cytosol and nucleus. Orthologous to human PSMB5 (proteasome 20S subunit beta 5); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,3-dinitrobenzene; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

beta-5; macropain epsilon chain; multicatalytic endopeptidase complex epsilon chain; proteasome (prosome, macropain) subunit, beta type 5; proteasome beta 5 subunit; proteasome beta type subunit 5; proteasome chain 6; proteasome epsilon chain; proteasome subunit beta 5; proteasome subunit beta type-5; proteasome subunit X

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMB5 (proteasome 20S subunit beta 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Psmb5 (proteasome (prosome, macropain) subunit, beta type 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmb5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMB5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMB5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmb5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMB5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMB5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmb5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Psmb5 (proteasome 20S subunit beta 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NME7 (NME/NM23 family member 7)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Psmb5 (proteasome (prosome, macropain) subunit, beta type 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PSMB5 (proteasome 20S subunit beta 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmb5 (proteasome subunit beta 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRE2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta5R1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta5R2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	pbs-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pbs-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psmb5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psmb5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	32,042,784 - 32,047,379 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	32,042,787 - 32,047,379 (-)	Ensembl				GRCr8
mRatBN7.2	15	28,072,772 - 28,077,367 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	28,072,781 - 28,077,440 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	29,911,955 - 29,916,437 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	31,059,168 - 31,063,650 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,308,790 - 29,313,379 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,259,039 - 33,263,634 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,259,043 - 33,263,659 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	37,143,058 - 37,147,105 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	32,689,859 - 32,694,364 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	27,651,286 - 27,655,779 (-)	NCBI		Celera
RGSC_v3.1	15	32,705,562 - 32,710,051 (-)	NCBI
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Myocardial Ischemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-nitrofluorene (EXP)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

aflatoxin B1 (EXP)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

arsenite(3-) (ISO)

astemizole (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bortezomib (EXP,ISO)

bromobenzene (EXP)

butane-2,3-dione (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chlorpyrifos (EXP,ISO)

clobetasol (ISO)

clofibrate (EXP,ISO)

clozapine (ISO)

Cuprizon (ISO)

cypermethrin (ISO)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (EXP)

doxorubicin (ISO)

endosulfan (EXP)

fenvalerate (EXP)

finasteride (EXP)

flutamide (EXP)

furan (EXP)

furfural (ISO)

glucose (ISO)

glyphosate (ISO)

heparin (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

isoprenaline (EXP)

isotretinoin (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

metam (ISO)

methapyrilene (EXP)

N,N-diethyl-m-toluamide (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

nobiletin (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (EXP)

phenobarbital (EXP)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

Pyridostigmine bromide (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

ritonavir (EXP)

rotenone (ISO)

sibutramine (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

stattic (ISO)

sulindac (EXP)

tamoxifen (EXP,ISO)

Tanshinone I (ISO)

theophylline (EXP)

thiram (ISO)

trichloroethene (EXP)

tunicamycin (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vinclozolin (EXP)

vitamin E (ISO)

WP1066 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteasomal protein catabolic process (IEA,ISO,NAS)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA,IEA,ISO)

proteolysis (IEA,ISO)

proteolysis involved in protein catabolic process (IEA)

regulation of proteasomal protein catabolic process (IEA,ISO)

response to oxidative stress (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IBA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

proteasome complex (IEA,ISO)

proteasome core complex (IEA,ISO,ISS)

proteasome core complex, beta-subunit complex (IBA,ISS)

synaptic vesicle (NAS)

Molecular Function

endopeptidase activity (IBA)

hydrolase activity (IEA)

peptidase activity (IEA,ISO)

protein binding (ISO)

threonine-type endopeptidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	An abundance of free regulatory (19S) proteasome particles regulates neuronal synapses.	Sun C, etal., Science. 2023 May 26;380(6647):eadf2018. doi: 10.1126/science.adf2018. Epub 2023 May 26.

Additional References at PubMed

PMID:2335214	PMID:8889548	PMID:15198663	PMID:16857966	PMID:17323924	PMID:17540904	PMID:19056867	PMID:20498273	PMID:21059646	PMID:21630459	PMID:22793692	PMID:22871113
PMID:23376485	PMID:25931508	PMID:30361391

Genomics

Comparative Map Data

Psmb5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	32,042,784 - 32,047,379 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	32,042,787 - 32,047,379 (-)	Ensembl				GRCr8
mRatBN7.2	15	28,072,772 - 28,077,367 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	28,072,781 - 28,077,440 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	29,911,955 - 29,916,437 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	31,059,168 - 31,063,650 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	29,308,790 - 29,313,379 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	33,259,039 - 33,263,634 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	33,259,043 - 33,263,659 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	37,143,058 - 37,147,105 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	32,689,859 - 32,694,364 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	27,651,286 - 27,655,779 (-)	NCBI		Celera
RGSC_v3.1	15	32,705,562 - 32,710,051 (-)	NCBI
Cytogenetic Map	15	p13	NCBI

PSMB5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	23,025,851 - 23,035,220 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	23,016,543 - 23,035,230 (-)	Ensembl			hg38	GRCh38
GRCh37	14	23,495,060 - 23,504,429 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	22,564,900 - 22,573,949 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	22,564,899 - 22,573,949	NCBI
Celera	14	3,357,950 - 3,367,323 (-)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	3,612,363 - 3,621,723 (-)	NCBI		HuRef
CHM1_1	14	23,493,694 - 23,503,063 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	17,226,471 - 17,235,840 (-)	NCBI		T2T-CHM13v2.0

Psmb5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	54,851,577 - 54,855,452 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	54,851,576 - 54,855,479 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	54,614,120 - 54,617,995 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	54,614,119 - 54,618,022 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	55,232,957 - 55,236,832 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	53,568,325 - 53,572,200 (-)	NCBI		MGSCv36	mm8
Celera	14	52,402,497 - 52,406,386 (-)	NCBI		Celera
Cytogenetic Map	14	C2	NCBI
cM Map	14	27.86	NCBI

Psmb5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	37,268,980 - 37,279,937 (+)	Ensembl
ChiLan1.0	NW_004955409	37,269,319 - 37,278,957 (+)	NCBI	ChiLan1.0	ChiLan1.0

PSMB5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	24,458,581 - 24,467,983 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	23,675,069 - 23,684,471 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	3,845,951 - 3,855,335 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	21,943,432 - 21,952,169 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	21,943,432 - 21,952,169 (-)	Ensembl			panPan2	panpan1.1

PSMB5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	3,344,157 - 3,349,921 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	3,344,233 - 3,349,926 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	3,292,754 - 3,298,523 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	3,452,136 - 3,457,902 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	3,452,139 - 3,457,839 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,143,540 - 3,149,316 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	3,204,769 - 3,210,546 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	3,466,833 - 3,472,610 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Psmb5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	35,095,360 - 35,103,510 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	1,285,482 - 1,295,106 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	1,285,488 - 1,293,637 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMB5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	76,014,576 - 76,021,922 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	81,329,736 - 81,337,082 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMB5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	23,394,820 - 23,403,953 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	23,390,401 - 23,403,658 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	23,013,024 - 23,022,186 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmb5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	9,505,725 - 9,513,034 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624820	9,506,119 - 9,513,034 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Psmb5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	70,382,226 - 70,387,127 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Psmb5
12 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000018005
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	32342855	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	16911521	32439851	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Markers in Region

RH128069

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	28,072,795 - 28,072,995 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	33,259,063 - 33,259,262	NCBI	Rnor6.0
Rnor_5.0	15	37,143,082 - 37,143,281	UniSTS	Rnor5.0
RGSC_v3.4	15	32,689,883 - 32,690,082	UniSTS	RGSC3.4
Celera	15	27,651,310 - 27,651,509	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI602737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB783917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018005 ⟹ ENSRNOP00000018005

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	32,042,787 - 32,047,379 (-)	Ensembl
mRatBN7.2 Ensembl	15	28,072,781 - 28,077,440 (-)	Ensembl
Rnor_6.0 Ensembl	15	33,259,043 - 33,263,659 (-)	Ensembl

RefSeq Acc Id:

NM_001105727 ⟹ NP_001099197

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	32,042,784 - 32,047,379 (-)	NCBI
mRatBN7.2	15	28,072,772 - 28,077,367 (-)	NCBI
Rnor_6.0	15	33,259,039 - 33,263,634 (-)	NCBI
Rnor_5.0	15	37,143,058 - 37,147,105 (-)	NCBI
RGSC_v3.4	15	32,689,859 - 32,694,364 (-)	RGD
Celera	15	27,651,286 - 27,655,779 (-)	RGD

Sequence:

show sequence

CCTTGCTAAACATGGCGCTGGCCAGCGTGTTGCAGCGGCCGATGCCGGTGAATCAGCACGGGTT
TTTTGGACTCGGAGGTCGTGCAGATCTGCTGGACTTGGGTCCGGGGAGTCCTGGTGATGGGCTG
AGCCTAGCCGCGCCGAGCTGGGGTGTCCCGGAGGAGCCACGAATCGAAATGCTTCATGGAACCA
CCACCCTGGCCTTCAAGTTTCAGCATGGAGTCATTGTTGCAGCGGATTCCCGGGCCACCGCAGG
TGCCTACATTGCTTCCCAGACAGTGAAGAAAGTGATAGAGATCAACCCTTACCTTCTGGGCACC
ATGGCTGGGGGTGCAGCGGATTGCAGCTTCTGGGAGCGGTTGTTGGCTCGACAGTGTCGAATCT
ATGAGCTTCGCAACAAGGAACGCATCTCGGTCGCGGCGGCCTCCAAACTGCTTGCCAACATGGT
GTATCAGTACAAAGGCATGGGGCTGTCCATGGGCACCATGATCTGTGGCTGGGATAAGAGAGGC
CCGGGCCTCTACTATGTAGACAGTGAGGGGAACAGGATCTCTGGAACCGCCTTCTCAGTGGGAT
CTGGCTCCGTGTATGCGTTTGGAGTCATGGATCGAGGCTACTCCTATGACCTACAAGTGGAGGA
GGCCTATGACCTGGCCCGCCGAGCCATCTACCAAGCCACCTACAGAGATGCCTACTCCGGAGGA
GCAGTCAACCTCTACCATGTGCGGGAGGATGGCTGGATCCGTGTCTCCAGTGACAATGTAGCTG
ACTTACATGACAAGTATACTTCATCTATCCCCTGAGGGAAGGTGGAGTGCCCTGGTTATAATAA
ATAATAGTACCCGTTCCATAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099197	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14180	(Get FASTA)	NCBI Sequence Viewer
	EDM14181	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018005
GenBank Protein	P28075	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001099197 ⟸ NM_001105727

- UniProtKB:

P28075 (UniProtKB/Swiss-Prot), G3V7Q6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLA
FKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELR
NKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSV
YAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHD
KYTSSIP

hide sequence

Ensembl Acc Id:

ENSRNOP00000018005 ⟸ ENSRNOT00000018005

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28075-F1-model_v2	AlphaFold	P28075	1-263	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699656

Promoter ID:

EPDNEW_R10179

Type:

multiple initiation site

Name:

Psmb5_1

Description:

proteasome subunit beta 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	33,263,646 - 33,263,706	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61879	AgrOrtholog
BioCyc Gene	G2FUF-13792	BioCyc
Ensembl Genes	ENSRNOG00000013386	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000018005	ENTREZGENE
Gene3D-CATH	3.60.20.10	UniProtKB/Swiss-Prot
InterPro	Ntn_hydrolases_N	UniProtKB/Swiss-Prot
	Pept_T1A_subB	UniProtKB/Swiss-Prot
	Proteasome_bsu_CS	UniProtKB/Swiss-Prot
	Proteasome_sua/b	UniProtKB/Swiss-Prot
	Proteasome_suB-type	UniProtKB/Swiss-Prot
KEGG Report	rno:29425	UniProtKB/Swiss-Prot
NCBI Gene	29425	ENTREZGENE
PANTHER	METALLOPROTEASE TLDD	UniProtKB/Swiss-Prot
	PROTEASOME SUBUNIT BETA	UniProtKB/Swiss-Prot
Pfam	Proteasome	UniProtKB/Swiss-Prot
PhenoGen	Psmb5	PhenoGen
PRINTS	PROTEASOME	UniProtKB/Swiss-Prot
PROSITE	PROTEASOME_BETA_1	UniProtKB/Swiss-Prot
	PROTEASOME_BETA_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013386	RatGTEx
Superfamily-SCOP	SSF56235	UniProtKB/Swiss-Prot
UniProt	A6KGV2_RAT	UniProtKB/TrEMBL
	G3V7Q6	ENTREZGENE, UniProtKB/TrEMBL
	P28075	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	Psmb5	proteasome 20S subunit beta 5	Psmb5	proteasome subunit beta 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-08-19	Psmb5	proteasome subunit beta 5	Psmb5	proteasome (prosome, macropain) subunit, beta type 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Psmb5	proteasome (prosome, macropain) subunit, beta type 5			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)