Advanced Search (OLGA)

Gene: Npy4r (neuropeptide Y receptor Y4) Rattus norvegicus

Analyze

Symbol:

Npy4r

Name:

neuropeptide Y receptor Y4

RGD ID:

61864

Description:

Enables pancreatic polypeptide receptor activity and peptide binding activity. Predicted to be involved in neuropeptide signaling pathway. Predicted to be located in membrane. Predicted to be active in neuron projection and plasma membrane. Orthologous to several human genes including NPY4R (neuropeptide Y receptor Y4); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

VALIDATED

Previously known as:

neuropeptide Y receptor type 4; NPY4-R; pancreatic polypeptide receptor 1; PP1; Ppyr1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPY4R (neuropeptide Y receptor Y4)	HGNC	Ensembl, Inparanoid, OMA, Panther, PhylomeDB
Mus musculus (house mouse):	Npy4r (neuropeptide Y receptor Y4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Npy4r (neuropeptide Y receptor Y4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100985913 (neuropeptide Y receptor type 4-2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPY4R (neuropeptide Y receptor Y4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPY4R (neuropeptide Y receptor Y4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NPY4R2 (neuropeptide Y receptor Y4-2)	HGNC	Ensembl, NCBI, Panther
Homo sapiens (human):	CRMP1 (collapsin response mediator protein 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Npy4r (neuropeptide Y receptor Y4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NPY4R (neuropeptide Y receptor Y4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	npy4r (neuropeptide Y receptor Y4)	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	npy4r (neuropeptide Y receptor Y4)	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	npy8br (neuropeptide Y receptor Y8b)	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Danio rerio (zebrafish):	npy8ar (neuropeptide Y receptor Y8a)	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Homo sapiens (human):	NPY4R2 (neuropeptide Y receptor Y4-2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-11	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-11	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	NPFR	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	NPFR	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-12	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-12	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-5	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	npy4r	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	XB996286 [provisional:npy4r]	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	9,474,051 - 9,475,307 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	9,472,011 - 9,482,405 (+)	Ensembl				GRCr8
mRatBN7.2	16	9,467,801 - 9,469,057 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	9,467,801 - 9,469,057 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	9,481,156 - 9,482,412 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	10,625,865 - 10,627,121 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	9,476,211 - 9,477,467 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	16	9,473,204 - 9,474,460 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	16	9,471,602 - 9,472,858 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	16	9,470,463 - 9,471,719 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	16	9,495,989 - 9,497,245 (-)	NCBI		F344_StmMcwi
Rnor_6.0	16	10,489,450 - 10,490,706 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	10,489,450 - 10,490,706 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	8,808,683 - 8,809,939 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	9,787,170 - 9,788,426 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	5,747,166 - 5,748,422 (+)	NCBI		Celera
RGSC_v3.1	16	9,787,167 - 9,788,424 (-)	NCBI
Cytogenetic Map	16	p15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzene-1,2,4-triol (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

Cuprizon (EXP)

dexamethasone (ISO)

folic acid (ISO)

indometacin (ISO)

Licochalcone B (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

N-ethyl-N-nitrosourea (EXP)

okadaic acid (ISO)

paracetamol (ISO)

PCB138 (ISO)

S-nitrosoglutathione (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

testosterone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell communication (IEA)

G protein-coupled receptor signaling pathway (IEA,ISO)

neuropeptide signaling pathway (IBA)

signal transduction (IEA)

signaling (IEA)

Cellular Component

membrane (IEA,ISO)

neuron projection (IBA)

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

neuropeptide Y receptor activity (IEA)

pancreatic polypeptide receptor activity (IBA,IDA,ISO)

peptide binding (IMP)

peptide hormone binding (ISO)

peptide YY receptor activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The cloned rat pancreatic polypeptide receptor exhibits profound differences to the orthologous receptor.	Lundell I, etal., Proc Natl Acad Sci U S A 1996 May 14;93(10):5111-5.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors.	Yan H, etal., Proc Natl Acad Sci U S A 1996 May 14;93(10):4661-5.

Additional References at PubMed

PMID:7493937	PMID:7592911	PMID:8641440	PMID:9210181	PMID:10698177	PMID:16950545	PMID:35453028

Genomics

Comparative Map Data

Npy4r
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	9,474,051 - 9,475,307 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	9,472,011 - 9,482,405 (+)	Ensembl				GRCr8
mRatBN7.2	16	9,467,801 - 9,469,057 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	9,467,801 - 9,469,057 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	9,481,156 - 9,482,412 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	10,625,865 - 10,627,121 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	9,476,211 - 9,477,467 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	16	9,473,204 - 9,474,460 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	16	9,471,602 - 9,472,858 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	16	9,470,463 - 9,471,719 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	16	9,495,989 - 9,497,245 (-)	NCBI		F344_StmMcwi
Rnor_6.0	16	10,489,450 - 10,490,706 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	10,489,450 - 10,490,706 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	8,808,683 - 8,809,939 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	9,787,170 - 9,788,426 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	5,747,166 - 5,748,422 (+)	NCBI		Celera
RGSC_v3.1	16	9,787,167 - 9,788,424 (-)	NCBI
Cytogenetic Map	16	p15	NCBI

NPY4R
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	46,461,099 - 46,470,668 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	46,457,895 - 46,465,958 (-)	Ensembl			hg38	GRCh38
GRCh37	10	47,083,457 - 47,088,320 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	46,503,540 - 46,508,326 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	46,503,539 - 46,508,325	NCBI
Cytogenetic Map	10	q11.22	NCBI
CHM1_1	10	47,901,251 - 47,906,033 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	47,347,139 - 47,357,909 (-)	NCBI		T2T-CHM13v2.0

Npy4r
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	33,867,603 - 33,874,376 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	33,865,949 - 33,874,446 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	34,145,646 - 34,152,419 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	34,143,992 - 34,152,489 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	34,958,832 - 34,965,605 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	32,973,084 - 32,981,581 (-)	NCBI		MGSCv36	mm8
Celera	14	30,407,960 - 30,414,733 (-)	NCBI		Celera
Cytogenetic Map	14	B	NCBI
cM Map	14	20.8	NCBI

Npy4r
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955510	6,198,051 - 6,199,169 (+)	Ensembl
ChiLan1.0	NW_004955510	6,198,051 - 6,199,169 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100985913
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	59,498,601 - 59,505,133 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	59,503,918 - 59,510,353 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	43,769,740 - 43,776,225 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	46,822,670 - 46,827,451 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

NPY4R
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	34,816,566 - 34,820,774 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	34,804,534 - 34,811,739 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	35,173,909 - 35,181,111 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	35,177,642 - 35,178,769 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	4	35,187,785 - 35,194,992 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	35,694,368 - 35,701,559 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

NPY4R
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	14	88,276,340 - 88,283,720 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	95,760,996 - 95,768,322 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Npy4r
7 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	4234212	16278352	Rat
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	387123	45387123	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33425095	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39568015	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4234212	53708481	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	4744222	49744222	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4234212	16278352	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	1	26734272	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26734272	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	4354822	49354822	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	387123	45387123	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4234212	49757901	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	66955197	Rat
737825	Alc13	Alcohol consumption QTL 13	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	16061395	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39568015	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	839086	66195506	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3386790	49757901	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3386790	26128267	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	839086	66195506	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	839086	66195506	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26734272	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4234333	17730812	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	839086	52786090	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	839086	66195506	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	3301683	48301683	Rat

Markers in Region

PMC60063P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	9,468,017 - 9,468,749 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	10,489,667 - 10,490,398	NCBI	Rnor6.0
Rnor_5.0	16	8,808,900 - 8,809,631	UniSTS	Rnor5.0
RGSC_v3.4	16	9,787,387 - 9,788,118	UniSTS	RGSC3.4
Celera	16	5,747,474 - 5,748,205	UniSTS
Cytogenetic Map	16	p16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	25	121	62	61	36	20	36	6	143	64	104	34	91	25	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001444607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_031581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U42388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U84245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z68180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000083105 ⟹ ENSRNOP00000069607

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	9,472,011 - 9,482,405 (+)	Ensembl
mRatBN7.2 Ensembl	16	9,467,801 - 9,469,057 (-)	Ensembl
Rnor_6.0 Ensembl	16	10,489,450 - 10,490,706 (-)	Ensembl

RefSeq Acc Id:

NM_031581 ⟹ NP_113769

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	9,474,051 - 9,475,307 (-)	NCBI
mRatBN7.2	16	9,467,801 - 9,469,057 (-)	NCBI
Dahl_SR_JrHsd	16	9,473,204 - 9,474,460 (-)	NCBI
Lyon_Normotensive	16	9,471,602 - 9,472,858 (-)	NCBI
Lyon_Hypertensive	16	9,470,463 - 9,471,719 (-)	NCBI
F344_StmMcwi	16	9,495,989 - 9,497,245 (-)	NCBI
Rnor_6.0	16	10,489,450 - 10,490,706 (-)	NCBI
Rnor_5.0	16	8,808,683 - 8,809,939 (-)	NCBI
RGSC_v3.4	16	9,787,170 - 9,788,426 (-)	RGD
Celera	16	5,747,166 - 5,748,422 (+)	RGD

Sequence:

show sequence

GCAGGCTACACTCAGAAGTGGGCCCTTTAGTCTTGAAGTTCCTGGTCTTCTCACACCCACCATG
AATACCTCTCATCTCATGGCCTCCCTTTCTCCGGCATTCCTACAAGGTAAGAATGGGACCAACT
CACTGGATTCCCTCTATAATCTCTCTGACGGCTGCCAGGATTCGGCAGATCTGTTGGCCTTCAT
CATCACCACCTACAGCGTTGAGACCGTCTTGGGGGTCCTAGGAAACCTCTGCTTGATATTTGTG
ACCACAAGGCAAAAGGAAAAGTCCAATGTGACCAACCTACTCATTGCCAACCTGGCCTTCTCTG
ACTTCCTCATGTGTCTCATCTGCCAGCCGCTCACGGTCACCTACACCATCATGGACTACTGGAT
CTTCGGCGAAGTCCTTTGCAAGATGTTAACGTTCATCCAGTGTATGTCGGTGACAGTCTCCATC
CTCTCACTGGTCCTTGTGGCCCTGGAGAGGCACCAGCTCATTATCAACCCGACTGGCTGGAAAC
CCAGCATTTCCCAGGCCTACCTGGGGATTGTGGTCATCTGGTTCATTTCTTGTTTCCTCTCCTT
GCCCTTCCTGGCCAATAGCATCCTGAACGACCTCTTCCACTACAACCACTCTAAGGTTGTGGAG
TTTCTGGAAGACAAGGTTGTCTGCTTTGTGTCCTGGTCCTCGGATCACCACCGCCTCATCTACA
CCACCTTTCTGCTGCTCTTCCAATACTGCGTCCCTCTGGCCTTCATCCTGGTCTGCTACATGCG
TATCTACCAGCGCCTGCAGAGGCAGAGGCGTGCGTTCCACACGCACACTTGCAGCTCACGAGTG
GGGCAGATGAAGCGGATCAATGGCATGCTCATGGCAATGGTGACTGCCTTTGCAGTTCTCTGGC
TGCCCCTGCATGTGTTCAACACTCTGGAGGACTGGTACCAGGAAGCCATCCCTGCTTGCCATGG
CAACCTCATCTTCTTGATGTGCCACCTGTTTGCCATGGCTTCCACCTGTGTCAACCCTTTCATC
TATGGCTTTCTCAACATCAACTTCAAGAAGGACATCAAGGCTCTGGTTCTGACCTGCCGTTGCA
GGCCACCTCAAGGGGAGCCTGAGCCTCTGCCCCTGTCCACTGTGCACACGGACCTCTCCAAGGG
ATCTATGAGGATGGGTAGCAAGTCTAACGTCATGTAGTCATGTCTAGGCTCTTCCGCCATTTTC
TTTCGACACACCCTTTCACTGAGCTAAGTAGACACAATGCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001431536	(Get FASTA)	NCBI Sequence Viewer
	NP_113769	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB07761	(Get FASTA)	NCBI Sequence Viewer
	AAB87736	(Get FASTA)	NCBI Sequence Viewer
	CAA92322	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069607.1
GenBank Protein	Q63447	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113769 ⟸ NM_031581

- UniProtKB:

Q62892 (UniProtKB/Swiss-Prot), Q63447 (UniProtKB/Swiss-Prot), A6KFT0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNTSHLMASLSPAFLQGKNGTNSLDSLYNLSDGCQDSADLLAFIITTYSVETVLGVLGNLCLIF
VTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFIQCMSVTVS
ILSLVLVALERHQLIINPTGWKPSISQAYLGIVVIWFISCFLSLPFLANSILNDLFHYNHSKVV
EFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCVPLAFILVCYMRIYQRLQRQRRAFHTHTCSSR
VGQMKRINGMLMAMVTAFAVLWLPLHVFNTLEDWYQEAIPACHGNLIFLMCHLFAMASTCVNPF
IYGFLNINFKKDIKALVLTCRCRPPQGEPEPLPLSTVHTDLSKGSMRMGSKSNVM

hide sequence

Ensembl Acc Id:

ENSRNOP00000069607 ⟸ ENSRNOT00000083105

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63447-F1-model_v2	AlphaFold	Q63447	1-375	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61864	AgrOrtholog
BioCyc Gene	G2FUF-12071	BioCyc
Ensembl Genes	ENSRNOG00000061026	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000083105.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	NPY4_rcpt	UniProtKB/Swiss-Prot
	NPY_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:29471	UniProtKB/Swiss-Prot
NCBI Gene	29471	ENTREZGENE
PANTHER	NEUROPEPTIDE Y RECEPTOR	UniProtKB/Swiss-Prot
	PTHR24235:SF25	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Npy4r	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	NRPEPTIDEY4R	UniProtKB/Swiss-Prot
	NRPEPTIDEYR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000061026	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6KFT0	ENTREZGENE, UniProtKB/TrEMBL
	NPY4R_RAT	UniProtKB/Swiss-Prot
	Q62892	ENTREZGENE
	Q63447	ENTREZGENE
UniProt Secondary	Q62892	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-04-04	Npy4r	neuropeptide Y receptor Y4	Ppyr1	pancreatic polypeptide receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ppyr1	pancreatic polypeptide receptor 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_homology	75% amino acid sequence identity to human homolog	729496

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message