Advanced Search (OLGA)

Gene: Pcsk1n (proprotein convertase subtilisin/kexin type 1 inhibitor) Rattus norvegicus

Analyze

Symbol:

Pcsk1n

Name:

proprotein convertase subtilisin/kexin type 1 inhibitor

RGD ID:

3617

Description:

Enables endopeptidase inhibitor activity. Predicted to be involved in neuropeptide signaling pathway. Predicted to act upstream of or within peptide hormone processing; response to cold; and response to dietary excess. Located in extracellular space. Used to study obesity. Orthologous to human PCSK1N (proprotein convertase subtilisin/kexin type 1 inhibitor); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

granin-like neuroendocrine peptide; granin-like neuroendocrine peptide precursor; LOC100911286; LOC108348172; pro-SAAS; proprotein convertase 1 inhibitor; proSAAS; proSAAS-like; Saas

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	17,251,963 - 17,255,405 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	17,251,965 - 17,257,360 (-)	Ensembl				GRCr8
mRatBN7.2	X	14,580,036 - 14,583,478 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	14,580,038 - 14,583,566 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	19,393,585 - 19,397,012 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	20,686,099 - 20,689,526 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	16,951,269 - 16,954,696 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	15,324,263 - 15,327,705 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,324,400 - 15,327,684 (-)	NCBI			rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,324,400 - 15,327,684 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,425,078 - 15,428,518 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,425,078 - 15,428,518 (-)	NCBI			rn6	Rnor6.0
Rnor_5.0	X	16,104,504 - 16,107,946 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	26,614,585 - 26,618,027 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	14,664,791 - 14,668,241 (-)	NCBI		Celera
RGSC_v3.1	X	26,668,055 - 26,671,496 (-)	NCBI
Cytogenetic Map	X	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenoid cystic carcinoma (ISO)

Alzheimer's disease (ISO)

Dehydration (IEP)

dementia (ISO)

obesity (IAGP,ISO)

Salivary Gland Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (ISO)

cisplatin (ISO)

clozapine (ISO)

cocaine (ISO)

corosolic acid (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

dibutyl phthalate (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

ethanol (EXP,ISO)

fenvalerate (EXP)

folic acid (ISO)

gentamycin (EXP)

haloperidol (ISO)

L-methionine (ISO)

lead(0) (ISO)

methimazole (EXP)

morphine (ISO)

N-nitrosodiethylamine (EXP)

nitroglycerin (EXP)

paracetamol (EXP)

PCB138 (ISO)

phenethyl caffeate (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

thiram (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

neuropeptide signaling pathway (IEA)

peptide hormone processing (ISO)

response to cold (ISO)

response to dietary excess (ISO)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IDA,IEA,ISO)

Golgi apparatus (IEA)

secretory granule (IEA,ISO)

trans-Golgi network (IEA,ISO)

Molecular Function

endopeptidase inhibitor activity (IBA,IDA,IEA)

serine-type endopeptidase inhibitor activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of incompletely processed potential carboxypeptidase E substrates from CpEfat/CpEfat mice.	Bures EJ, etal., Proteomics. 2001 Jan;1(1):79-92.
2.	Identification and characterization of proSAAS, a granin-like neuroendocrine peptide precursor that inhibits prohormone processing.	Fricker LD, etal., J Neurosci 2000 Jan 15;20(2):639-48.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Dehydration-induced proteome changes in the rat hypothalamo-neurohypophyseal system.	Gouraud SS, etal., Endocrinology. 2007 Jul;148(7):3041-52. Epub 2007 Apr 5.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Embryonic gene expression and pro-protein processing of proSAAS during rodent development.	Morgan DJ, etal., J Neurochem. 2005 Jun;93(6):1454-62.
8.	Processing of proSAAS in neuroendocrine cell lines.	Mzhavia N, etal., Biochem J. 2002 Jan 1;361(Pt 1):67-76.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	A human granin-like neuroendocrine peptide precursor (proSAAS) immunoreactivity in tau inclusions of Alzheimer's disease and parkinsonism-dementia complex on Guam.	Wada M, etal., Neurosci Lett. 2004 Feb 6;356(1):49-52.
14.	Obesity and diabetes in transgenic mice expressing proSAAS.	Wei S, etal., J Endocrinol. 2004 Mar;180(3):357-68.

Additional References at PubMed

PMID:9630436	PMID:10816562	PMID:16631141	PMID:23376485	PMID:25002582

Genomics

Comparative Map Data

Pcsk1n
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	17,251,963 - 17,255,405 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	17,251,965 - 17,257,360 (-)	Ensembl				GRCr8
mRatBN7.2	X	14,580,036 - 14,583,478 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	14,580,038 - 14,583,566 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	19,393,585 - 19,397,012 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	20,686,099 - 20,689,526 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	16,951,269 - 16,954,696 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	15,324,263 - 15,327,705 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,324,400 - 15,327,684 (-)	NCBI			rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,324,400 - 15,327,684 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,425,078 - 15,428,518 (-)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,425,078 - 15,428,518 (-)	NCBI			rn6	Rnor6.0
Rnor_5.0	X	16,104,504 - 16,107,946 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	26,614,585 - 26,618,027 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	14,664,791 - 14,668,241 (-)	NCBI		Celera
RGSC_v3.1	X	26,668,055 - 26,671,496 (-)	NCBI
Cytogenetic Map	X	q12	NCBI

PCSK1N
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	48,831,096 - 48,835,610 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	48,831,088 - 48,835,632 (-)	Ensembl			hg38	GRCh38
GRCh37	X	48,689,506 - 48,694,012 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	48,574,450 - 48,578,904 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	X	48,445,755 - 48,450,209	NCBI
Celera	X	52,969,569 - 52,974,023 (+)	NCBI		Celera
Cytogenetic Map	X	p11.23	NCBI
HuRef	X	46,349,219 - 46,353,523 (-)	NCBI		HuRef
CHM1_1	X	48,720,646 - 48,725,174 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	48,241,591 - 48,246,097 (-)	NCBI		T2T-CHM13v2.0

Pcsk1n
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	7,786,061 - 7,790,649 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	7,786,061 - 7,790,649 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	X	7,919,822 - 7,924,410 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	7,919,822 - 7,924,410 (+)	Ensembl			mm10	GRCm38
MGSCv37	X	7,496,948 - 7,501,536 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	X	7,076,781 - 7,080,194 (+)	NCBI		MGSCv36	mm8
Celera	X	3,544,922 - 3,549,511 (-)	NCBI		Celera
Cytogenetic Map	X	A1.1	NCBI
cM Map	X	3.57	NCBI

Pcsk1n
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955543	384,123 - 387,744 (-)	Ensembl
ChiLan1.0	NW_004955543	383,984 - 387,885 (-)	NCBI	ChiLan1.0	ChiLan1.0

PCSK1N
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	50,320,252 - 50,324,769 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	50,323,624 - 50,328,141 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	41,128,785 - 41,133,284 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	48,988,782 - 48,994,021 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	48,988,948 - 48,990,028 (-)	Ensembl			panPan2	panpan1.1

PCSK1N
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	42,030,708 - 42,036,363 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	41,962,524 - 42,036,586 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	16,406,140 - 16,411,765 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	42,166,878 - 42,172,506 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	42,166,878 - 42,172,740 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	42,153,141 - 42,158,765 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	42,141,418 - 42,147,043 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	42,235,574 - 42,241,199 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pcsk1n
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	34,543,584 - 34,547,318 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936721	782,032 - 787,952 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936721	783,973 - 787,712 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PCSK1N
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	42,947,692 - 42,949,024 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	X	42,947,688 - 42,952,222 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	47,889,000 - 47,893,572 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PCSK1N
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	45,957,760 - 45,962,588 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	45,957,715 - 45,962,601 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666076	11,437,561 - 11,442,355 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pcsk1n
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624893	632,930 - 636,664 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624893	632,514 - 636,656 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pcsk1n
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	X	14,212,613 - 14,216,118 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pcsk1n
248 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	124
Count of miRNA genes:	66
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000009794, ENSRNOT00000075774
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	4001493	44939387	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1970440	46970440	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	8111486	53111486	Rat
634325	Bw13	Body weight QTL 13	0		body mass (VT:0001259)	body weight (CMO:0000012)	X	4001493	24470521	Rat

Markers in Region

BI283701

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	X	165.3	UniSTS
Cytogenetic Map	X	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	sensory system	visual system
7	1	18	48	67	138	95	11	47	36	32	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF181561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009794 ⟹ ENSRNOP00000009794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	X	15,324,400 - 15,327,684 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075774 ⟹ ENSRNOP00000066891

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	17,251,965 - 17,255,493 (-)	Ensembl
mRatBN7.2 Ensembl	X	14,580,038 - 14,583,566 (-)	Ensembl
Rnor_6.0 Ensembl	X	15,425,078 - 15,428,518 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000173696 ⟹ ENSRNOP00000101085

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	17,251,965 - 17,257,360 (-)	Ensembl

RefSeq Acc Id:

NM_019279 ⟹ NP_062152

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	17,251,963 - 17,255,405 (-)	NCBI
mRatBN7.2	X	14,580,036 - 14,583,478 (-)	NCBI
Rnor_6.0	X	15,324,263 - 15,327,705 (-)	NCBI
Rnor_5.0	X	16,104,504 - 16,107,946 (-)	NCBI
RGSC_v3.4	X	26,614,585 - 26,618,027 (-)	RGD
Celera	X	14,664,791 - 14,668,241 (-)	RGD

Sequence:

show sequence

AGCCCGGCTCGTTGGGGCAGCATGGCGGGGTCGCCGCTGCTCTGCGGGCCGAGGGCCGGGGGCG
TAGGCCTTTTGGTGCTGCTGCTCTTGGGTCTTCTGAGGCTGCCCCCCACCTTGTCAGCGAGGCC
CGTGAAGGAACCCCGCAGTCTGAGCGCAGCATCCGCGCCCTTGGCTGAGACGAGCACTCCCCTC
CGCTTGCGTCGGGCCGTGCCCCGAGGAGAGGCGGCGGGTGCGGTGCAGGAGCTGGCGCGGGCGC
TGGCGCACCTGCTGGAGGCCGAGAGACAGGAGCGCGCGCGTGCTGAGGCGCAGGAGGCGGAGGA
TCAGCAGGCACGGGTCCTGGCACAGCTGCTGCGCGCCTGGGGCTCCCCGCGTGCCTCGGACCCG
CCCTTGGCCCCGGATGACGACCCGGACGCTCCCGCTGCACAGCTCGCCCGTGCTCTGCTCCGAG
CTCGCCTAGACCCGGCCGCCCTGGCGGCTCAGCTTGTCCCCGCCCCTGCCCCTGCCGCTGCGCT
GCGACCCCGGCCCCCAGTGTATGACGATGGCCCCACCGGCCCAGACGTCGAGGATGCCGCTGAC
GAGACTCCTGATGTGGACCCTGAGCTGCTGAGGTACTTGCTAGGGCGGATCCTCACCGGAAGTT
CGGAGCCAGAGGCTGCTCCGGCCCCGCGCCGCCTCCGCCGAGCTGTGGACCAGGATTTGGGTCC
CGAGGTGCCTCCTGAGAACGTACTGGGGGCTCTGCTACGCGTCAAACGTCTCGAGAACTCCTCG
CCCCAGGCACCGGCACGCCGCCTCCTGCCTCCCTGAGCGCTACTACATTCTGCACGCCCTGGAA
CCCAGGAGCGCCCCAGCAACCCTGACTCCCTGCCAGCACGTCCACGGCTGCTTACCCCGGCAAC
CTCCCATCCCCTGAGCCCTCCCTCAATAAATGCAATCTGTAGCAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_062152	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF22642	(Get FASTA)	NCBI Sequence Viewer
	EDL83811	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066891
GenBank Protein	Q9QXU9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062152 ⟸ NM_019279
- Peptide Label:	precursor
- UniProtKB:	Q9QXU9 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAGSPLLCGPRAGGVGLLVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLAETSTPLRLRRAVP RGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDD PDAPAAQLARALLRARLDPAALAAQLVPAPAPAAALRPRPPVYDDGPTGPDVEDAADETPDVDP ELLRYLLGRILTGSSEPEAAPAPRRLRRAVDQDLGPEVPPENVLGALLRVKRLENSSPQAPARR LLPP hide sequence

Ensembl Acc Id:

ENSRNOP00000066891 ⟸ ENSRNOT00000075774

Ensembl Acc Id:

ENSRNOP00000009794 ⟸ ENSRNOT00000009794

Ensembl Acc Id:

ENSRNOP00000101085 ⟸ ENSRNOT00000173696

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QXU9-F1-model_v2	AlphaFold	Q9QXU9	1-260	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701738

Promoter ID:

EPDNEW_R12259

Type:

initiation region

Name:

Pcsk1n_1

Description:

proprotein convertase subtilisin/kexin type 1 inhibitor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	15,327,754 - 15,327,814	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3617	AgrOrtholog
BioCyc Gene	G2FUF-2931	BioCyc
Ensembl Genes	ENSRNOG00000007112	Ensembl
	ENSRNOG00000046021	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000075774	ENTREZGENE
InterPro	ProSAAS	UniProtKB/Swiss-Prot
KEGG Report	rno:246333	UniProtKB/Swiss-Prot
NCBI Gene	Pcsk1n	ENTREZGENE
PANTHER	PROSAAS	UniProtKB/Swiss-Prot
	PTHR15531	UniProtKB/Swiss-Prot
Pfam	ProSAAS	UniProtKB/Swiss-Prot
PhenoGen	Pcsk1n	PhenoGen
RatGTEx	ENSRNOG00000007112	RatGTEx
	ENSRNOG00000046021	RatGTEx
TIGR	TC205564
UniProt	A0ABK0LIQ8_RAT	UniProtKB/TrEMBL
	A6KP63_RAT	UniProtKB/TrEMBL
	G3V6X7_RAT	UniProtKB/TrEMBL
	PCSK1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Pcsk1n	proprotein convertase subtilisin/kexin type 1 inhibitor	LOC108348172	proSAAS	Data merged from RGD:11409911	737654	PROVISIONAL
2016-08-02	LOC108348172	proSAAS			Symbol and Name status set to provisional	70820	PROVISIONAL
2015-07-29	Pcsk1n	proprotein convertase subtilisin/kexin type 1 inhibitor	LOC100911286	proSAAS-like	Data merged from RGD:6493991	737654	PROVISIONAL
2012-07-05	LOC100911286	proSAAS-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2003-04-09	Pcsk1n	proprotein convertase subtilisin/kexin type 1 inhibitor			Symbol and Name updated	629477	APPROVED
2003-03-06	Pcsk1n	proprotein convertase subtilisin/kexin type 1 inhibitor	Saas	granin-like neuroendocrine peptide precursor	Data merged from RGD:620567	628472	PROVISIONAL
2002-08-07	Saas	granin-like neuroendocrine peptide precursor			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-02-20	Pcsk1n	proprotein convertase subtilisin/kexin type 1 inhibitor			Symbol and Name updated to reflect Human and Mouse nomenclature	70282	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_process	inhibits prohormone convertase 1 activity	69973

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD